Probable L,D-transpeptidase ErfK/SrfK (erfK) Recombinant Protein | erfK recombinant protein
Recombinant Escherichia coli Probable L,D-transpeptidase ErfK/SrfK (erfK)
Gene Names
ldtA; ECK1985; erfK; JW1968; srfK; yeeG; yzzT
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable L; D-transpeptidase ErfK/SrfK (erfK); Recombinant Escherichia coli Probable L; erfK recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-310, full length protein
Sequence
VTYPLPPEGSRLVGQSFTVTVPDHNTQPLETFAAQYGQGLSNMLEANPGADVFLPKSGSQLTIPQQLILPDTVRKGIVVNVAEMRLYYYPPDSNTVEVFPIGIGQAGRETPRNWVTTVERKQEAPTWTPTPNTRREYAKRGESLPAFVPAGPDNPMGLYAIYIGRLYAIHGTNANFGIGLRVSQGCIRLRNDDIKYLFDNVPVGTRVQIIDQPVKYTTEPDGSNWLEVHEPLSRNRAEYESDRKVPLPVTPSLRAFINGQEVDVNRANAALQRRSGMPVQISSGSRQMF
Sequence Length
289
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,411 Da
NCBI Official Full Name
L,D-transpeptidase linking Lpp to murein
NCBI Official Symbol
ldtA
NCBI Official Synonym Symbols
ECK1985; erfK; JW1968; srfK; yeeG; yzzT
NCBI Protein Information
L,D-transpeptidase linking Lpp to murein
UniProt Protein Name
Probable L,D-transpeptidase ErfK/SrfK
Protein Family
UniProt Gene Name
erfK
UniProt Synonym Gene Names
yeeG; yzzT
NCBI Description
ErfK family. [More information is available at EcoGene: EG12682]. ErfK is an L,D-transpeptidase responsible removal of the D-alanine residue of peptidoglycan tetrapeptide stems and attachment of the lysine residue of Braun lipoprotein to the meso-diaminopimelyl (DAP) residue of the resulting tripeptide. [More information is available at EcoCyc: G7073].
Uniprot Description
Responsible, at least in part, for anchoring of the major outer membrane lipoprotein (Lpp, also known as the Braun lipoprotein) to the peptidoglycan via a meso-diaminopimelyl-L-Lys- bond on the terminal residue of Lpp.
Research Articles on erfK
Similar Products
Product Notes
The erfK erfk (Catalog #AAA1226922) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-310, full length protein. The amino acid sequence is listed below: VTYPLPPEGS RLVGQSFTVT VPDHNTQPLE TFAAQYGQGL SNMLEANPGA DVFLPKSGSQ LTIPQQLILP DTVRKGIVVN VAEMRLYYYP PDSNTVEVFP IGIGQAGRET PRNWVTTVER KQEAPTWTPT PNTRREYAKR GESLPAFVPA GPDNPMGLYA IYIGRLYAIH GTNANFGIGL RVSQGCIRLR NDDIKYLFDN VPVGTRVQII DQPVKYTTEP DGSNWLEVHE PLSRNRAEYE SDRKVPLPVT PSLRAFINGQ EVDVNRANAA LQRRSGMPVQ ISSGSRQMF. It is sometimes possible for the material contained within the vial of "Probable L,D-transpeptidase ErfK/SrfK (erfK), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
