Rabbit anti-Human PRKCZ Polyclonal Antibody | anti-PRKCZ antibody

PRKCZ (Protein Kinase C zeta Type, nPKC-zeta, PKC2) (AP)

Cat. Num. AAA6390758

• Gene Names: PRKCZ; PKC2; PKC-ZETA
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PRKCZ; Polyclonal Antibody; PRKCZ (Protein Kinase C zeta Type; nPKC-zeta; PKC2) (AP); anti-PRKCZ antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PRKCZ.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-PRKCZ antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human PRKCZ, aa1-592 (NP_002735.3).
• Immunogen Sequence: MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PRKCZ expression in transfected 293T cell line by PRKCZ polyclonal antibody. Lane 1: PRKCZ transfected lysate (67.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PRKCZ and AKT3. HeLa cells were stained with PRKCZ rabbit purified polyclonal 1:1200 and AKT3 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-PRKCZ antibody

Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a constitutive kinase activity which is independent of calcium, and PKC activators, phosphatidylserine and diacylglycerol. Furthermore, it is insensitive to PKC inhibitors and cannot be activated by phorbol ester. The structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC.

Product Categories/Family for anti-PRKCZ antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 52486327
• NCBI GeneID: 5590
• NCBI Accession #: NP_002735.3
• NCBI GenBank Nucleotide #: NM_002744.4
• UniProt Accession #: Q05513; Q15207; Q5SYT5; Q969S4; A8K4N0; A8MU64; B7Z2J7; E9PCW2
• Molecular Weight: 56,136 Da
• NCBI Official Full Name: protein kinase C zeta type isoform 1
• NCBI Official Synonym Full Names: protein kinase C, zeta
• NCBI Official Symbol: PRKCZ
• NCBI Official Synonym Symbols: PKC2; PKC-ZETA
• NCBI Protein Information: protein kinase C zeta type; nPKC-zeta
• UniProt Protein Name: Protein kinase C zeta type
• Protein Family: Protein kinase
• UniProt Gene Name: PRKCZ
• UniProt Synonym Gene Names: PKC2
• UniProt Entry Name: KPCZ_HUMAN

NCBI Description

Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

PKCZ: an AGC kinase of the PKC family. An atypical PKC: its activity is not regulated by Ca2+, PS, DAG or phorbol esters. Constitutively active.

Protein type: EC 2.7.11.13; Protein kinase, AGC; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; AGC group; PKC family; Iota subfamily

Chromosomal Location of Human Ortholog: 1p36.33-p36.2

Cellular Component: tight junction; nuclear matrix; apical cortex; leading edge; nuclear envelope; intercellular junction; cytosol; lipid raft; axon hillock; filamentous actin; membrane; perinuclear region of cytoplasm; apical plasma membrane; cytoplasm; plasma membrane; microtubule organizing center; cell junction; endosome

Molecular Function: protein serine/threonine kinase activity; protein domain specific binding; protein binding; protein kinase C activity; potassium channel regulator activity; phospholipase binding; insulin receptor substrate binding; metal ion binding; protein kinase binding; ATP binding; protein kinase activity

Biological Process: protein heterooligomerization; membrane hyperpolarization; negative regulation of insulin receptor signaling pathway; signal transduction; protein amino acid phosphorylation; activation of NF-kappaB transcription factor; positive regulation of interleukin-4 production; positive regulation of glucose import; positive regulation of T-helper 2 cell differentiation; negative regulation of hydrolase activity; transforming growth factor beta receptor signaling pathway; positive regulation of cell proliferation; vesicle transport along microtubule; inflammatory response; positive regulation of cell-matrix adhesion; platelet activation; negative regulation of peptidyl-tyrosine phosphorylation; phospholipase D activation; cell migration; activation of protein kinase B; microtubule cytoskeleton organization and biogenesis; peptidyl-serine phosphorylation; long-term memory; establishment of cell polarity; actin cytoskeleton reorganization; insulin receptor signaling pathway; positive regulation of insulin receptor signaling pathway; blood coagulation; vascular endothelial growth factor receptor signaling pathway; negative regulation of protein complex assembly; negative regulation of apoptosis