Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-GNA15 Polyclonal Antibody)

Rabbit anti-Human, Mouse GNA15 Polyclonal Antibody | anti-GNA15 antibody

GNA15 Polyclonal Antibody

Gene Names
GNA15; GNA16
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
GNA15; Polyclonal Antibody; GNA15 Polyclonal Antibody; GNA16; G protein subunit alpha 15; anti-GNA15 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.22 mg/ml (varies by lot)
Sequence Length
374
Applicable Applications for anti-GNA15 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 112-374 of human GNA15 (NP_002059.3).
Immunogen Sequence
HASLVMSQDPYKVTTFEKRYAAAMQWLWRDAGIRACYERRREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVRDSVLARYLDEINLL
Positive Samples
LO2, HeLa, Mouse Spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-GNA15 Polyclonal Antibody)

Western Blot (WB) (Western blot-GNA15 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 43kDa
Observed: 43kDa
NCBI Official Full Name
Guanine nucleotide-binding protein subunit alpha-15
NCBI Official Synonym Full Names
G protein subunit alpha 15
NCBI Official Symbol
GNA15
NCBI Official Synonym Symbols
GNA16
NCBI Protein Information
guanine nucleotide-binding protein subunit alpha-15
UniProt Protein Name
Guanine nucleotide-binding protein subunit alpha-15
UniProt Gene Name
GNA15
UniProt Synonym Gene Names
GNA16; G alpha-15; G-protein subunit alpha-15; G alpha-16; G-protein subunit alpha-16
UniProt Entry Name
GNA15_HUMAN

Uniprot Description

G-alpha 15: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Belongs to the G-alpha family. G(q) subfamily.

Protein type: G protein; G protein, heterotrimeric; G protein, heterotrimeric alpha G(q)

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: plasma membrane; heterotrimeric G-protein complex

Molecular Function: GTPase activity; signal transducer activity; G-protein-coupled receptor binding; GTP binding; metal ion binding; G-protein beta/gamma-subunit binding

Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; platelet activation; elevation of cytosolic calcium ion concentration; phospholipase C activation; metabolic process; dopamine receptor, phospholipase C activating pathway; blood coagulation; muscarinic acetylcholine receptor, phospholipase C activating pathway

Research Articles on GNA15

Similar Products

Product Notes

The GNA15 gna15 (Catalog #AAA9140996) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNA15 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GNA15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the GNA15 gna15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GNA15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.