Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Epithelial membrane protein 3 (EMP3) Recombinant Protein | EMP3 recombinant protein

Recombinant Human Epithelial membrane protein 3 (EMP3)

Gene Names
EMP3; YMP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Epithelial membrane protein 3 (EMP3); Recombinant Human Epithelial membrane protein 3 (EMP3); Recombinant Epithelial membrane protein 3 (EMP3); Epithelial membrane protein 3; EMP-3; Hematopoietic neural membrane protein 1; HNMP-1 Protein YMP; EMP3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-163
Sequence
MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
Sequence Length
163
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,429 Da
NCBI Official Full Name
epithelial membrane protein 3
NCBI Official Synonym Full Names
epithelial membrane protein 3
NCBI Official Symbol
EMP3
NCBI Official Synonym Symbols
YMP
NCBI Protein Information
epithelial membrane protein 3; EMP-3; HNMP-1; hematopoietic neural membrane protein 1
UniProt Protein Name
Epithelial membrane protein 3
UniProt Gene Name
EMP3
UniProt Synonym Gene Names
YMP; EMP-3; HNMP-1
UniProt Entry Name
EMP3_HUMAN

NCBI Description

The protein encoded by this gene belongs to the PMP-22/EMP/MP20 family of proteins. The protein contains four transmembrane domains and two N-linked glycosylation sites. It is thought to be involved in cell proliferation, cell-cell interactions and function as a tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]

Uniprot Description

EMP3: Probably involved in cell proliferation and cell-cell interactions. Belongs to the PMP-22/EMP/MP20 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: plasma membrane; integral to membrane

Molecular Function: protein binding

Biological Process: cell death; negative regulation of cell proliferation; bleb formation; cell growth

Research Articles on EMP3

Similar Products

Product Notes

The EMP3 emp3 (Catalog #AAA967070) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-163. The amino acid sequence is listed below: MSLLLLVVSA LHILILILLF VATLDKSWWT LPGKESLNLW YDCTWNNDTK TWACSNVSEN GWLKAVQVLM VLSLILCCLS FILFMFQLYT MRRGGLFYAT GLCQLCTSVA VFTGALIYAI HAEEILEKHP RGGSFGYCFA LAWVAFPLAL VSGIIYIHLR KRE. It is sometimes possible for the material contained within the vial of "Epithelial membrane protein 3 (EMP3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.