Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (43.67kD).)

Mouse anti-Human EMP3 Monoclonal Antibody | anti-EMP3 antibody

EMP3 (Epithelial Membrane Protein 3, YMP, EMP-3, Hematopoietic Neural Membrane Protein 1, HNMP-1, Protein YMP)

Gene Names
EMP3; YMP
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
EMP3; Monoclonal Antibody; EMP3 (Epithelial Membrane Protein 3; YMP; EMP-3; Hematopoietic Neural Membrane Protein 1; HNMP-1; Protein YMP); Anti -EMP3 (Epithelial Membrane Protein 3; anti-EMP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D4
Specificity
Recognizes human EMP3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
Applicable Applications for anti-EMP3 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Full length recombinant corresponding to aa1-163 from human EMP3 (AAH09718) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (43.67kD).)

Western Blot (WB) (Western Blot detection against Immunogen (43.67kD).)

Western Blot (WB)

(EMP3 monoclonal antibody, Western Blot analysis of EMP3 expression in C32.)

Western Blot (WB) (EMP3 monoclonal antibody, Western Blot analysis of EMP3 expression in C32.)

Western Blot (WB)

(Western Blot analysis of EMP3 expression in transfected 293T cell line by EMP3 monoclonal antibody.|Lane 1: EMP3 transfected lysate (18.429kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EMP3 expression in transfected 293T cell line by EMP3 monoclonal antibody.|Lane 1: EMP3 transfected lysate (18.429kD).|Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EMP3 on formalin-fixed paraffin-embedded human lymphoma tissue. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to EMP3 on formalin-fixed paraffin-embedded human lymphoma tissue. [antibody concentration 3ug/ml].)
Related Product Information for anti-EMP3 antibody
Epithelial membrane protein 3 (EMP3) is a multipass transmembrane protein in the peripheral myelin protein 22 family. It is expressed as a 20-25kD molecule depending on the degree of glycosylation. EMP3 interacts with the P2X7 purinergic receptor on monocytes. Its dysregulation is associated with glioma and neuroblastoma. Human EMP3 shares 93% aa sequence identity with mouse and rat EMP3.
Product Categories/Family for anti-EMP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,429 Da
NCBI Official Full Name
epithelial membrane protein 3
NCBI Official Synonym Full Names
epithelial membrane protein 3
NCBI Official Symbol
EMP3
NCBI Official Synonym Symbols
YMP
NCBI Protein Information
epithelial membrane protein 3; EMP-3; HNMP-1; hematopoietic neural membrane protein 1
UniProt Protein Name
Epithelial membrane protein 3
UniProt Gene Name
EMP3
UniProt Synonym Gene Names
YMP; EMP-3; HNMP-1
UniProt Entry Name
EMP3_HUMAN

NCBI Description

The protein encoded by this gene belongs to the PMP-22/EMP/MP20 family of proteins. The protein contains four transmembrane domains and two N-linked glycosylation sites. It is thought to be involved in cell proliferation, cell-cell interactions and function as a tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]

Uniprot Description

EMP3: Probably involved in cell proliferation and cell-cell interactions. Belongs to the PMP-22/EMP/MP20 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: plasma membrane; integral to membrane

Molecular Function: protein binding

Biological Process: cell death; negative regulation of cell proliferation; bleb formation; cell growth

Research Articles on EMP3

Similar Products

Product Notes

The EMP3 emp3 (Catalog #AAA6003272) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EMP3 (Epithelial Membrane Protein 3, YMP, EMP-3, Hematopoietic Neural Membrane Protein 1, HNMP-1, Protein YMP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EMP3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the EMP3 emp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSLLLLVVSA LHILILILLF VATLDKSWWT LPGKESLNLW YDCTWNNDTK TWACSNVSEN GWLKAVQVLM VLSLILCCLS FILFMFQLYT MRRGGLFYAT GLCQLCTSVA VFTGALIYAI HAEEILEKHP RGGSFGYCFA LAWVAFPLAL VSGIIYIHLR KRE. It is sometimes possible for the material contained within the vial of "EMP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.