Rabbit anti-Human EMP3 Polyclonal Antibody | anti-EMP3 antibody

EMP3 (Epithelial Membrane Protein 3, YMP, EMP-3, Hematopoietic Neural Membrane Protein 1, HNMP-1, Protein YMP)

Cat. Num. AAA6005703

• Gene Names: EMP3; YMP
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: EMP3; Polyclonal Antibody; EMP3 (Epithelial Membrane Protein 3; YMP; EMP-3; Hematopoietic Neural Membrane Protein 1; HNMP-1; Protein YMP); Anti -EMP3 (Epithelial Membrane Protein 3; anti-EMP3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human EMP3.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE

• Applicable Applications for anti-EMP3 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human EMP3, aa1-163 (NP_001416.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of EMP3 expression in transfected 293T cell line by EMP3 polyclonal antibody. Lane 1: EMP3 transfected lysate (18.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-EMP3 antibody

Epithelial membrane protein 3 (EMP3) is a multipass transmembrane protein in the peripheral myelin protein 22 family. It is expressed as a 20-25kD molecule depending on the degree of glycosylation. EMP3 interacts with the P2X7 purinergic receptor on monocytes. Its dysregulation is associated with glioma and neuroblastoma. Human EMP3 shares 93% aa sequence identity with mouse and rat EMP3.

Product Categories/Family for anti-EMP3 antibody

Antibodies; Abs to Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4503563
• NCBI GeneID: 2014
• NCBI Accession #: NP_001416.1
• NCBI GenBank Nucleotide #: NM_001425.2
• UniProt Accession #: P54852; Q6FH01
• Molecular Weight: 18,429 Da
• NCBI Official Full Name: epithelial membrane protein 3
• NCBI Official Synonym Full Names: epithelial membrane protein 3
• NCBI Official Symbol: EMP3
• NCBI Official Synonym Symbols: YMP
• NCBI Protein Information: epithelial membrane protein 3; EMP-3; HNMP-1; hematopoietic neural membrane protein 1
• UniProt Protein Name: Epithelial membrane protein 3
• Protein Family: Epithelial membrane protein
• UniProt Gene Name: EMP3
• UniProt Synonym Gene Names: YMP; EMP-3; HNMP-1
• UniProt Entry Name: EMP3_HUMAN

NCBI Description

The protein encoded by this gene belongs to the PMP-22/EMP/MP20 family of proteins. The protein contains four transmembrane domains and two N-linked glycosylation sites. It is thought to be involved in cell proliferation, cell-cell interactions and function as a tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]

Uniprot Description

EMP3: Probably involved in cell proliferation and cell-cell interactions. Belongs to the PMP-22/EMP/MP20 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: plasma membrane; integral to membrane

Molecular Function: protein binding

Biological Process: cell death; negative regulation of cell proliferation; bleb formation; cell growth