Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Endothelin-1 receptor (EDNRA) Recombinant Protein | EDNRA recombinant protein

Recombinant Human Endothelin-1 receptor (EDNRA)

Gene Names
EDNRA; ETA; ET-A; ETAR; ETRA; MFDA; ETA-R; hET-AR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Endothelin-1 receptor (EDNRA); Recombinant Human Endothelin-1 receptor (EDNRA); EDNRA recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-427. Full-Length of the Mature Protein
Sequence
DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

SDS-PAGE
Related Product Information for EDNRA recombinant protein
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
Product Categories/Family for EDNRA recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48.5 kDa
NCBI Official Full Name
endothelin-1 receptor isoform b
NCBI Official Synonym Full Names
endothelin receptor type A
NCBI Official Symbol
EDNRA
NCBI Official Synonym Symbols
ETA; ET-A; ETAR; ETRA; MFDA; ETA-R; hET-AR
NCBI Protein Information
endothelin-1 receptor
UniProt Protein Name
Endothelin-1 receptor
Protein Family
UniProt Gene Name
EDNRA
UniProt Synonym Gene Names
ETA; ETRA; ET-A; ETA-R; hET-AR
UniProt Entry Name
EDNRA_HUMAN

NCBI Description

This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Uniprot Description

EDNRA: Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3. Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Receptor, GPCR; GPCR, family 1; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 4q31.22

Cellular Component: cytosol; integral to plasma membrane; lipid raft; nuclear membrane; plasma membrane; T-tubule

Molecular Function: endothelin receptor activity; phosphoinositide phospholipase C activity; protein binding

Biological Process: adenylate cyclase activation; aging; artery smooth muscle contraction; cell proliferation; elevation of cytosolic calcium ion concentration; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); enteric nervous system development; fibroblast proliferation; G-protein coupled receptor protein signaling pathway; glomerular filtration; glucose transport; heart development; histamine secretion; in utero embryonic development; maternal process involved in parturition; negative regulation of apoptosis; negative regulation of cAMP biosynthetic process; neural crest cell development; patterning of blood vessels; penile erection; phospholipase C activation; positive regulation of cell proliferation; positive regulation of inflammatory response; positive regulation of odontogenesis; positive regulation of release of sequestered calcium ion into cytosol; protein kinase C activation; regulation of blood pressure; regulation of epithelial cell proliferation; respiratory gaseous exchange; response to hypoxia; response to lipopolysaccharide; response to morphine; Rho protein signal transduction; sensory perception of pain; signal transduction; smooth muscle cell proliferation; smooth muscle contraction; vasoconstriction

Disease: Mandibulofacial Dysostosis With Alopecia; Migraine With Or Without Aura, Susceptibility To, 1

Research Articles on EDNRA

Similar Products

Product Notes

The EDNRA ednra (Catalog #AAA7014159) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-427. Full-Length of the Mature Protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the EDNRA ednra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DNPERYSTNL SNHVDDFTTF RGTELSFLVT THQPTNLVLP SNGSMHNYCP QQTKITSAFK YINTVISCTI FIVGMVGNAT LLRIIYQNKC MRNGPNALIA SLALGDLIYV VIDLPINVFK LLAGRWPFDH NDFGVFLCKL FPFLQKSSVG ITVLNLCALS VDRYRAVASW SRVQGIGIPL VTAIEIVSIW ILSFILAIPE AIGFVMVPFE YRGEQHKTCM LNATSKFMEF YQDVKDWWLF GFYFCMPLVC TAIFYTLMTC EMLNRRNGSL RIALSEHLKQ RREVAKTVFC LVVIFALCWF PLHLSRILKK TVYNEMDKNR CELLSFLLLM DYIGINLATM NSCINPIALY FVSKKFKNCF QSCLCCCCYQ SKSLMTSVPM NGTSIQWKNH DQNNHNTDRS SHKDSMN . It is sometimes possible for the material contained within the vial of "Endothelin-1 receptor (EDNRA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.