VEGF-F (Bothrops insularis) Active Protein | VEGF-F active protein

Snake VEGF-F (Bothrops insularis)

Cat. Num. AAA691882

• Reactivity: Snake
• Purity: > 95% by SDS-PAGE & silver stain
• Synonyms: VEGF-F (Bothrops insularis); Snake VEGF-F (Bothrops insularis); Recombinant Snake Venom Vascular Endothelial Growth Factor-F; svVEGF; VEGF-F; VEGF-F active protein

• Host: E Coli
• Reactivity: Snake
• Purity/Purification: > 95% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: MGQVMPFMEVYRHSVCQTRETLVSILEEHPDEVSHIFRPSCVTALRCGGCCTDESLKCTATGKRSVGREIMRVDPHKGTSKTEVMQFTEHTDCECRPRSASGVNSRKHKRNPEEGEPRAKFPFV
• Sequence Length: 124

• Endotoxin Level: =0.13 ng per ug of sv-VEGF-F
• Biological Activity: Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) and human dermal lymphatic endothelial cells (HDLEC) using a concentration range of 2-50 ng/ml.
• Buffer: 50 mM acidic acid
• Stabilizer: None
• Reconstitution: The lyophilized svVEGF-F should be reconstituted in water or medium to a concentration not lower than 50 ?g/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
• Preparation and Storage: Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted svVEGF-F should be stored in working aliquots at -20 degree C. Avoid repeated freeze-thaw cycles!

SDS-PAGE

Testing Data

Testing Data

Testing Data

Testing Data

Related Product Information for VEGF-F active protein

Vascular endothelial growth factor (VEGF-A) and its family proteins are crucial regulators of blood vessel formation and vascular permeability. Snake venom has recently been shown to be an exogenous source of unique VEGF (known as VEGF-F), and now, two types of VEGF-F with distinct biochemical properties have been reported. VEGF-Fs (venom type VEGFs) are highly variable in structure and function among species, in contrast to endogenous tissue-type VEGFs (VEGF-As) of snakes. Although the structures of tissue-type VEGFs are highly conserved among venomous snake species and even among all vertebrates, including humans, those of venom-type VEGFs are extensively variegated, especially in the regions around receptor-binding loops and C-terminal putative coreceptor-binding regions, indicating that highly frequent variations are located around functionally key regions of the proteins. Genetic analyses suggest that venom-type VEGF gene may have developed from a tissue-type gene and that the unique sequence of its C-terminal region was generated by an alteration in the translation frame in the corresponding exons. The svVEGF-F was identified during the generation of abundant expressed sequence tags from the Viperidae snake Bothrops insularis venom glands. The deduced primary sequence, after complete sequencing of the longest snake venom VEGF (svVEGF) cDNA, displayed similarity with vertebrate VEGFs and with the hypotensive factor from Vipera aspis venom. The mature svVEGF appears to be ubiquitously distributed throughout snake venoms and was also confirmed by Northern blot studies of other related Viperidae species and by cDNA cloning of svVEGF from Bothrops jararaca pit viper. The produced recombinant protein dimerizes after refolding processes and was biologically characterized, showing ability to increase vascular permeability. These results established that svVEGF is a novel and important active toxin during the early stages of bothropic snake bite envenoming and represents a new member of the VEGF family of proteins.

Product Categories/Family for VEGF-F active protein

Cytokines & Growth Factors

References

1. Junqueira de Azevedo et al, JBC 276, 2001 2. Gasmi et al, JBC 276, 2002 3. Yamazaki et al, JBC 278, 2003 4. Takahashi et al, JBC 279, 2004 5. Yamazaki et al, JBC 280, 2005 6. Yamazaki et al, JBC 284, 2009

NCBI and Uniprot Product Information

• NCBI GI #: 48428664
• UniProt Accession #: Q90X24
• Molecular Weight: 27,6 kDa (Dimer)
• NCBI Official Full Name: Snake venom vascular endothelial growth factor toxin
• UniProt Protein Name: Snake venom vascular endothelial growth factor toxin
• UniProt Gene Name: svVEGF
• UniProt Synonym Gene Names: svVEGF
• UniProt Entry Name: TXVE_BOTIN

Uniprot Description

Function: Induces capillary permeability through VEGF (VEGFR) signaling. May also induce angiogenesis. Ref.1

Subunit structure: Homodimer; disulfide-linked. Ref.1 UniProtKB P15692

Subcellular location: Secreted Ref.1.

Tissue specificity: Expressed by the venom gland. Ref.1

Sequence similarities: Belongs to the PDGF/VEGF growth factor family. Snake venom VEGF subfamily.