VEGF206 active protein

Human VEGF206

Cat. Num. AAA691733

• Gene Names: VEGFA; VPF; VEGF; MVCD1
• Reactivity: Human
• Purity: >=75% by SDS-PAGE & Coomasie stain
• Synonyms: VEGF206; Human VEGF206; VEGF-A; VPF; VEGF206 active protein

• Host: E Coli
• Reactivity: Human
• Purity/Purification: >=75% by SDS-PAGE & Coomasie stain
• Form/Format: Lyophilized
• Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Sequence Length: 206

• Gene: vegf
• Reconstitution: Centrifuge vial prior to opening.; The lyophilized VEGF₂₀₆ should be reconstituted in 50mM acetic acid to a concentration not lower than 50 ug/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
• Biological Activity: The ED₅₀for stimulation of cell proliferation in human dermal lymphatic endothelial cells (HDLEC) by VEGF₂₀₆ has been determined to be in the range of 5-15 ng/ml.
• Stabilizer: None
• Result by N-terminal sequencing: APMAEGG
• Buffer: 50 mM acetic acid
• Length (aa): 206
• Preparation and Storage: The lyophilized protein is stable for a few weeks at room temperature, but best stored at –20°C. Reconstituted VEGF206 should be stored in working aliquots at –20°C. Avoid repeated freeze-thaw cycles.

SDS-PAGE

Testing Data

Related Product Information for VEGF206 active protein

Vascular endothelial growth factor-A (VEGF-A) mRNA undergoes alternative splicing events that generate several different homodimeric isoforms, e.g. VEGF121, VEGF145, VEGF165, VEGF189, and VEGF206. VEGF121 is a non-heparin-binding acidic protein, which is freely diffusible. The longer forms, VEGF189 or VEGF206, are highly basic proteins tightly bound to extracellular heparin-containing proteoglycans. VEGF165 has intermediate properties. VEGF165 was observed largely in Golgi apparatus-like structures. Immunogold labeling of cells expressing VEGF189 or VEGF206 revealed that the staining was localized to the subepithelial ECM. VEGF associated with the ECM was bioactive, because endothelial cells cultured on ECM derived from cells expressing VEGF189 or VEGF2O6 were markedly stimulated to proliferate. In addition, ECM-bound VEGF can be released into a soluble and bioactive form by heparin or plasmin. ECM-bound VEGF189 and VEGF206 have molecular masses consistent with the intact polypeptides. The ECM may represent an important source of VEGF and angiogenic potential. The isoforms VEGF145, VEGF165 and VEGF189 bind to heparin with high affinity, the affinity of VEGF206 is much weaker. All dimeric forms have similar biological activities but their bioavailability is very different. However so far there are only a few data about the biological activities of VEGF206.

Product Categories/Family for VEGF206 active protein

Cytokines & Growth Factors

References

1. Park JE et al, Mol Biol Cell 4:1317, 1993 2. Grützkau A et al, Mol Biol Cell 9:875, 1998 3. Breier et al., Dev 114:521, 1992 4. Fiebig et al., Eur J Biochem 211:19, 1993 5. Flamme et al., Dev Biol 162:699, 1995 6. Kremer at al., Cancer Res 57:3852, 1997

NCBI and Uniprot Product Information

• NCBI GI #: 76781480
• NCBI GeneID: 7422
• NCBI Accession #: NP_001165095
• NCBI GenBank Nucleotide #: NM_001171624
• UniProt Accession #: P15692-1; O60720; O75875; Q074Z4; Q16889; Q5UB46; Q6P0P5; Q96KJ0; Q96L82; Q96NW5; Q9H1W8; B5BU86; P15692
• Molecular Weight: ~47 kDa (Dimer)
• NCBI Official Full Name: vascular endothelial growth factor A isoform a
• NCBI Official Synonym Full Names: vascular endothelial growth factor A
• NCBI Official Symbol: VEGFA
• NCBI Official Synonym Symbols: VPF; VEGF; MVCD1
• NCBI Protein Information: vascular endothelial growth factor A; vascular permeability factor
• UniProt Protein Name: Vascular endothelial growth factor A
• UniProt Gene Name: VEGFA
• UniProt Synonym Gene Names: VEGF; VEGF-A; VPF
• UniProt Entry Name: VEGFA_HUMAN

NCBI Description

This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Ref.27 Ref.30 Ref.33

Subunit structure: Homodimer; disulfide-linked. Also found as heterodimer with PGF

By similarity.

Subcellular location: Secreted. Note: VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin. Ref.26 Ref.28 Ref.32

Tissue specificity: Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed.

Induction: Regulated by growth factors, cytokines, gonadotropins, nitric oxide, hypoxia, hypoglycemia and oncogenic mutations.

Involvement in disease: Microvascular complications of diabetes 1 (MVCD1) [MIM:603933]: Pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.

Sequence similarities: Belongs to the PDGF/VEGF growth factor family.

Sequence caution: The sequence AAC63102.1 differs from that shown. Reason: Erroneous initiation. The sequence AAC63143.1 differs from that shown. Reason: Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.The sequence CAC19512.2 differs from that shown. Reason: Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.The sequence CAC19516.2 differs from that shown. Reason: Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.