CNTF active protein

Rat CNTF

Cat. Num. AAA692144

• Reactivity: Rat
• Purity: > 98% by SDS-PAGE & silver stain
• Synonyms: CNTF; Rat CNTF; Recombinant Rat Ciliary Neurotrophic Factor (CNTF); Ciliary Neurotrophic Factor; CNTF active protein

• Host: E Coli
• Reactivity: Rat
• Purity/Purification: > 98% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLD SVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPT EGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGL FEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
• Sequence Length: 199

• Endotoxin Level: < 0.1ng per ug of CNTF
• Buffer: 5 mM sodium acetate, pH 6.5
• Preparation and Storage: The lyophilized powder although stable at room temperature for 3 weeks, is best stored desiccated at -20 degree C. Reconstituted rat CNTF should be stored in working aliquots at -20 degree C. For long term storage it is recommended to add a carrier protein (0.1% HAS or BSA).

Testing Data

Testing Data #2

Related Product Information for CNTF active protein

Ciliary neurotrophic factor (CNTF) is a polypeptide initially purified from chick embryo ocular tissue and identified as a trophic factor for embryonic chick ciliary parasympathetic neurons in culture. Subsequent studies have demonstrated that CNTF is a survival factor for additional neuronal cell types including: primary sensory neurons, motor neurons, basal forebrain neurons and type 2 astrocytes. CNTF has also been shown to prevent the degeneration of motor axons after axotomy. The cDNA for CNTF encodes a 200 amino acid residue polypeptide that lacks a signal sequence. CNTF is highly conserved across species and exhibits cross-species activities. Human and rat CNTF share approximately 83% homology in their protein sequence. CNTF is structurally related to IL6, IL11, LIF, and OSM. All of these four helix bundle cytokines share gp130 as a signal-transducing subunit in their receptor complexes. The cDNA for recombinant rat CNTF (Ala2 -Met200) was cloned from total RNA of a rat embryo using standard protocols. Ciliary Neurotrophic Factor (CNTF) is a potent neural factor that was originally characterized as a survivability factor for chick ciliary neurons in vitro. More recently, CNTF has been shown to promote survivability and differentiation of other neuronal cell types. Rat CNTF is a 22.7 kDa protein containing 199 amino acid residues.

Product Categories/Family for CNTF active protein

Cytokines & Growth Factors

References

1. Finn T and Nishi R, Perspect Dev Neurobiol 4, 1996. 2. Sendtner M et al, J Neurol Sci 124 Suppl:77-83, 1994. 3. Sendtner M et al, J Cell Sci Suppl 15, 1991.

NCBI and Uniprot Product Information

• NCBI GI #: 6978675
• NCBI GeneID: 25707
• NCBI Accession #: NP_037298.1
• NCBI GenBank Nucleotide #: NM_013166.1
• UniProt Accession #: P20294
• Molecular Weight: 22,7 kDa
• NCBI Official Full Name: ciliary neurotrophic factor
• NCBI Official Synonym Full Names: ciliary neurotrophic factor
• NCBI Official Symbol: Cntf
• NCBI Protein Information: ciliary neurotrophic factor; ciliary neurotropic factor
• UniProt Protein Name: Ciliary neurotrophic factor
• Protein Family: Ciliary neurotrophic factor
• UniProt Gene Name: Cntf
• UniProt Synonym Gene Names: CNTF
• UniProt Entry Name: CNTF_RAT

NCBI Description

a cytokine involved in neuronal degeneration and adipocyte gene expression [RGD, Feb 2006]

Uniprot Description

Function: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.

Subcellular location: Cytoplasm.

Tissue specificity: Nervous system.

Sequence similarities: Belongs to the CNTF family.