Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Leukemia Inhibitory Factor Active Protein | mLIF active protein

Recombinant Mouse Leukemia Inhibitory Factor

Purity
Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Leukemia Inhibitory Factor; Recombinant Mouse Leukemia Inhibitory Factor; LIF Mouse; Leukemia Inhibitory Factor Mouse Recombinant; CDF; HILDA; D-FACTOR; Differentiation- stimulating factor; Melanoma-derived LPL inhibitor; MLPLI; Emfilermin; Leukemia inhibitory factor; LIF; DIA; mLIF active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Sequence Length
158
Solubility
It is recommended to reconstitute the lyophilized Leukemia Inhibitory Factor (LIF) in sterile water not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
Activity of murine LIF was determined by the M1 cell differentiation assay which was found to be < 0.01 ng/ml, corresponding to a specific activity of 100,000,000 IU/mg.A standard of 50 Units is defined as the concentration of mouse LIF in 1.0 mL of tissue culture medium that induces the differentiation of 50% of M1 colonies.
Preparation and Storage
Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for mLIF active protein
Description: Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa. The Leukemia Inhibitory Factor (LIF) is purified by proprietary chromatographic techniques.

Introduction: Leukemia Inhibitory Factor also called LIF is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines & promotion of megakaryocyte production in vivo. Human and mouse LIF exhibit a 78% identity in its amino acid sequence.
Product Categories/Family for mLIF active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,287 Da
NCBI Official Full Name
leukemia inhibitory factor isoform b
NCBI Official Synonym Full Names
leukemia inhibitory factor
NCBI Official Symbol
Lif
NCBI Protein Information
leukemia inhibitory factor; d factor; differentiation-stimulating factor
UniProt Protein Name
Leukemia inhibitory factor
UniProt Gene Name
Lif
UniProt Synonym Gene Names
LIF; D factor
UniProt Entry Name
LIF_MOUSE

Uniprot Description

LIF: LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes. Belongs to the LIF/OSM family.

Protein type: Secreted; Secreted, signal peptide

Cellular Component: extracellular space; cytoplasm; extracellular region

Molecular Function: growth factor activity; leukemia inhibitory factor receptor binding; cytokine activity; receptor binding

Biological Process: transcription from RNA polymerase II promoter; maternal process involved in pregnancy; negative regulation of hormone secretion; leukemia inhibitory factor signaling pathway; tyrosine phosphorylation of Stat3 protein; decidualization; positive regulation of adrenocorticotropic hormone secretion; positive regulation of tyrosine phosphorylation of Stat3 protein; negative regulation of cell proliferation; positive regulation of MAPKKK cascade; astrocyte differentiation; regulation of cell differentiation; negative regulation of meiosis; positive regulation of cell proliferation; positive regulation of macrophage differentiation; muscle morphogenesis; positive regulation of astrocyte differentiation; positive regulation of peptidyl-serine phosphorylation of STAT protein; organ regeneration; stem cell maintenance; stem cell differentiation; positive regulation of peptidyl-serine phosphorylation; positive regulation of tyrosine phosphorylation of Stat1 protein; negative regulation of angiogenesis; positive regulation of peptidyl-tyrosine phosphorylation; retina development in camera-type eye; neuron development; positive regulation of transcription from RNA polymerase II promoter; immune response; blood vessel remodeling; alveolus development; embryo implantation; lung development

Research Articles on mLIF

Similar Products

Product Notes

The mLIF lif (Catalog #AAA143714) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MSPLPITPVN ATCAIRHPCH GNLMNQIKNQ LAQLNGSANA LFISYYTAQG EPFPNNVEKL CAPNMTDFPS FHGNGTEKTK LVELYRMVAY LSASLTNITR DQKVLNPTAV SLQVKLNATI DVMRGLLSNV LCRLCNKYRV GHVDVPPVPD HSDKEAFQRK KLGCQLLGTY KQVISVVVQA F. It is sometimes possible for the material contained within the vial of "Leukemia Inhibitory Factor, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.