SDS-Page
(Recombinant Human IL-36 alpha Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 17 kDa.)
IL-36 alpha Active Protein | IL36a active protein
Recombinant Human IL-36 alpha Protein
Gene Names
IL36A; FIL1; FIL1E; IL1F6; IL-1F6; IL1(EPSILON); FIL1(EPSILON)
Purity
>95% by SDS-PAGE.
Synonyms
IL-36 alpha; Recombinant Human IL-36 alpha Protein; FIL1; FIL1(EPSILON); FIL1E; IL-1F6; IL1(EPSILON); IL1F6; IL36a active protein
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Sequence Length
158
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL-36 alpha at 1 ug/mL (100 uL/well) can bind recombinant human IL-1 Rrp2 Fc Chimera with a linear range of 0.15-5 ug/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Human IL-36 alpha Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 17 kDa.)
SDS-Page
(Recombinant Human IL-36 alpha Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 17 kDa.)
Related Product Information for IL36a active protein
Description: Recombinant Human IL-36 alpha Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Phe158) of human IL-36 alpha (Accession #NP_055255.1) fused with a 6xHis tag at the C-terminus.
Background: Interleukin-1 family member 6 (IL-1F6), also known as interleukin 36, alpha (IL36A), is a pro-inflammatory cytokine which plays an important role in innate and adaptive immunity.IL-1F6 can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this protein has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients.
Background: Interleukin-1 family member 6 (IL-1F6), also known as interleukin 36, alpha (IL36A), is a pro-inflammatory cytokine which plays an important role in innate and adaptive immunity.IL-1F6 can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this protein has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients.
Product Categories/Family for IL36a active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-36 alpha
NCBI Official Synonym Full Names
interleukin 36 alpha
NCBI Official Symbol
IL36A
NCBI Official Synonym Symbols
FIL1; FIL1E; IL1F6; IL-1F6; IL1(EPSILON); FIL1(EPSILON)
NCBI Protein Information
interleukin-36 alpha
UniProt Protein Name
Interleukin-36 alpha
Protein Family
UniProt Gene Name
IL36A
UniProt Synonym Gene Names
FIL1E; IL1E; IL1F6; IL-1 epsilon; IL-1F6
UniProt Entry Name
IL36A_HUMAN
NCBI Description
The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients. [provided by RefSeq, Nov 2015]
Uniprot Description
IL1F6: Belongs to the IL-1 family.
Protein type: Cytokine
Chromosomal Location of Human Ortholog: 2q12-q14.1
Cellular Component: extracellular space; extracellular region
Molecular Function: interleukin-1 receptor binding; cytokine activity
Biological Process: cytokine and chemokine mediated signaling pathway; positive regulation of interleukin-6 production; innate immune response; immune response; inflammatory response
Research Articles on IL36a
Similar Products
Product Notes
The IL36a il36a (Catalog #AAA9139630) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MEKALKIDTP QQGSIQDINH RVWVLQDQTL IAVPRKDRMS PVTIALISCR HVETLEKDRG NPIYLGLNGL NLCLMCAKVG DQPTLQLKEK DIMDLYNQPE PVKSFLFYHS QSGRNSTFES VAFPGWFIAV SSEGGCPLIL TQELGKANTT DFGLTMLF. It is sometimes possible for the material contained within the vial of "IL-36 alpha, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
