Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

4-1BBL active protein

Human 4-1BBL

Gene Names
TNFSF9; CD137L; 4-1BB-L
Reactivity
Human
Purity
> 98% by SDS-PAGE and HPLC analyses
Synonyms
4-1BBL; Human 4-1BBL; Recombinant Human 4-1BBL; 4-1BBL active protein
Ordering
For Research Use Only!
Host
E Coli
Reactivity
Human
Purity/Purification
> 98% by SDS-PAGE and HPLC analyses
Form/Format
Lyophilized
Sequence
MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVS LTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQP LRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTE ARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Sequence Length
254
Endotoxin Level
< 0.1 ng per g of BAFF
Biological Activity
Determined by the dose-dependent stimulation of IL-8 production by human PBMC. The expected ED50 for this effect is 5-10 ng/ml. NOTE: Results may vary with different PBMC donors.
Related Product Information for 4-1BBL active protein
4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4-1BBL binds to its receptor 4-1BB, and provides a co-stimulatory signal for T cell activation and expansion. The human 4-1BBL gene codes for a 254 amino acid type II transmembrane containing a 28 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 205 amino acid extracellular domain. The soluble form of 4-1BBL contains the TNF-like portion of the extracellular domain of 4-1BBL. Recombinant human 4-1BBL is a soluble 19.5 kDa protein consisting of 185 amino acid residues.
Product Categories/Family for 4-1BBL active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.0 kDa
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 9
NCBI Official Synonym Full Names
tumor necrosis factor (ligand) superfamily, member 9
NCBI Official Symbol
TNFSF9
NCBI Official Synonym Symbols
CD137L; 4-1BB-L
NCBI Protein Information
tumor necrosis factor ligand superfamily member 9; 4-1BBL; 4-1BB ligand; receptor 4-1BB ligand; homolog of mouse 4-1BB-L
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 9
UniProt Gene Name
TNFSF9
UniProt Synonym Gene Names
4-1BBL
UniProt Entry Name
TNFL9_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.[provided by RefSeq, Oct 2008]

Uniprot Description

Function: Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages. Ref.3

Subunit structure: Homotrimer. Ref.3

Subcellular location: Membrane; Single-pass type II membrane protein.

Tissue specificity: Expressed in brain, placenta, lung, skeletal muscle and kidney.

Sequence similarities: Belongs to the tumor necrosis factor family.

Research Articles on 4-1BBL

Similar Products

Product Notes

The 4-1BBL tnfsf9 (Catalog #AAA691660) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human 4-1BBL reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MREGPELSPD DPAGLLDLRQ GMFAQLVAQN VLLIDGPLSW YSDPGLAGVS LTGGLSYKED TKELVVAKAG VYYVFFQLEL RRVVAGEGSG SVSLALHLQP LRSAAGAAAL ALTVDLPPAS SEARNSAFGF QGRLLHLSAG QRLGVHLHTE ARARHAWQLT QGATVLGLFR VTPEIPAGLP SPRSE. It is sometimes possible for the material contained within the vial of "4-1BBL, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.