Testing Data
GST-delta/GSTD2 (Bombyx mori (Silk moth)) Active Protein | GST delta active protein
GST-delta / GSTD2, Active Recombinant (Bombyx mori (Silk moth))
Gene Names
GSTd2; GSTt; Gstdelta
Applications
SDS-Page
Purity
>=95%
Synonyms
GST-delta/GSTD2 (Bombyx mori (Silk moth)); GST-delta / GSTD2; Active Recombinant (Bombyx mori (Silk moth)); Glutathione S-Transferase Delta; GSTd2; GST delta active protein
Host
E Coli
Purity/Purification
>=95%
Form/Format
2.0 mg/ml solution in 30% glycerol without additives.
Appearance: Liquid
Appearance: Liquid
Concentration
2.0 mg/ml (varies by lot)
Sequence
MGSSHHHHHHSSGLVPRGSH MTIDLYYVPG SAPCRAVLLT AKALNLNLNLKLVDLHHGEQLKPEYLKLNPQHTVPTLVDDG LSIWESRAIITYLVNKYAKGSSLYPEDPKARALVDQRLYFDIGTLYQRFSDYFYPQVFAGAPADKAKNEKVQ EALQLLDKFLEGQKYVAGPNLTVADLSLIASVSSLEASDIDFKKYAN VKRWYETVKSTAPGYQEANEKGLEAFKGLV NSMLKK
Sequence Length
216
Applicable Applications for GST delta active protein
SDS-PAGE
Endotoxin Level
< 1.0 EU per 1 mug of protein (determined by LAL method).
Activity (Specifications/test method)
>= 20 U/mg as determined with MyBioSource's GST colorimetric activity assay kit.
Biological Activity
>= 20 U/mg as determined with MyBioSource's GST colorimetric activity assay kit.
Results
>= 20 U/mg as determined with MyBioSource's GST colorimetric activity assay kit.
Unit Definition
One unit of the recombinant GST-delta is defined as the amount of enzyme that conjugates 1.0 umole of 1-chloro-2, 4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25 degree C.
Handling
Centrifuge the vial prior to opening.
Preparation and Storage
At -20 degree C
Shelf Life: 12 months
Shelf Life: 12 months
Testing Data
Testing Data
Related Product Information for GST delta active protein
Background: Glutathione S-transferase delta is an enzyme in Bombyx mori (Silk moth) encoded by the GSTd2 gene. GSTs are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into nine classes: alpha, delta, kappa, mu, omega, pi, theta, zeta and microsomal. GSTs play a role in susceptibility to cancer, and other diseases.
Product Categories/Family for GST delta active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.4 kDa (236 aa, 1-216 aa + His Tag)
NCBI Official Full Name
glutathione S-transferase delta 2
NCBI Official Symbol
GSTd2
NCBI Official Synonym Symbols
GSTt; Gstdelta
NCBI Protein Information
glutathione S-transferase delta 2
UniProt Protein Name
Glutathione S-transferase delta
UniProt Gene Name
GST delta
UniProt Entry Name
Q60GK5_BOMMO
Similar Products
Product Notes
The GST delta gst delta (Catalog #AAA845367) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GST-delta/GSTD2 (Bombyx mori (Silk moth)) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE. Researchers should empirically determine the suitability of the GST delta gst delta for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGSSHHHHHH SSGLVPRGSH MTIDLYYVPG SAPCRAVLLT AKALNLNLNL KLVDLHHGEQ LKPEYLKLNP QHTVPTLVDD G LSIWESRAII TYLVNKYAKG SSLYPEDPKA RALVDQRLYF DIGTLYQRFS DYFYPQVFAG APADKAKNEK VQ EALQLLDKFL EGQKYVAGPN LTVADLSLIA SVSSLEASDI DFKKYAN VKRWYETVKS TAPGYQEANE KGLEAFKGLV NSMLKK. It is sometimes possible for the material contained within the vial of "GST-delta/GSTD2 (Bombyx mori (Silk moth)), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
