GSTP1 active protein

Human Recombinant GSTP1

Cat. Num. AAA845119

• Gene Names: GSTP1; PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22
• Applications: SDS-Page
• Purity: >=95%
• Synonyms: GSTP1; Human Recombinant GSTP1; Glutathione S-transferase P; DFN7; FAEES3; GST3; PI; GSTP1 active protein

• Host: E Coli
• Purity/Purification: >=95%
• Form/Format: 2.0 mg/ml solution in 30% glycerol without additives.; Appearance: Liquid
• Concentration: 2 mg/ml (varies by lot)
• Sequence: MGSSHHHHHHSSGLVPRGSHMPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
• Sequence Length: 210

• Applicable Applications for GSTP1 active protein: SDS-PAGE
• Endotoxin Level: < 1.0 EU per 1 mug of protein (determined by LAL method).
• Biological Activity: Specific activity is 20 U/mg
• Unit Definition: One unit of the human recombinant GSTP1 is defined as the amount of enzyme that conjugates 1.0 umole of 1-chloro-2, 4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25 degree C.
• Handling: Centrifuge the vial prior to opening.
• Preparation and Storage: At -80 degree C; Shelf Life: 12 months

Testing Data

Related Product Information for GSTP1 active protein

Background: Glutathione S-transferase P is an enzyme that in humans is encoded by the GSTP1 gene. Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. The glutathione S-transferase pi gene (GSTP1) is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.

Product Categories/Family for GSTP1 active protein

Proteins and Enzymes; Proteins and Enzymes (A-Z)  

NCBI and Uniprot Product Information

• NCBI GI #: 4504183
• NCBI GeneID: 2950
• NCBI Accession #: NP_000843.1
• NCBI GenBank Nucleotide #: NM_000852.3
• UniProt Accession #: P09211; O00460; Q15690; Q5TZY3
• Molecular Weight: 27.6 kDa
• NCBI Official Full Name: glutathione S-transferase P
• NCBI Official Synonym Full Names: glutathione S-transferase pi 1
• NCBI Official Symbol: GSTP1
• NCBI Official Synonym Symbols: PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22
• NCBI Protein Information: glutathione S-transferase P
• UniProt Protein Name: Glutathione S-transferase P
• Protein Family: Glutathione S-transferase
• UniProt Gene Name: GSTP1
• UniProt Synonym Gene Names: FAEES3; GST3
• UniProt Entry Name: GSTP1_HUMAN

NCBI Description

Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq, Jul 2008]

Uniprot Description

GSTP1: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. Homodimer. Interacts with CDK5. Belongs to the GST superfamily. Pi family.

Protein type: Transferase; EC 2.5.1.18; Xenobiotic Metabolism - metabolism by cytochrome P450; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Other Amino Acids Metabolism - glutathione

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: extracellular space; mitochondrion; cytoplasm; plasma membrane; intracellular; cytosol; nucleus; vesicle

Molecular Function: JUN kinase binding; protein binding; glutathione transferase activity; kinase regulator activity

Biological Process: negative regulation of JNK activity; negative regulation of MAP kinase activity; central nervous system development; negative regulation of MAPKKK cascade; negative regulation of acute inflammatory response; negative regulation of interleukin-1 beta production; negative regulation of tumor necrosis factor production; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of stress-activated MAPK cascade; regulation of stress-activated MAPK cascade; response to reactive oxygen species; negative regulation of biosynthetic process; glutathione metabolic process; negative regulation of fibroblast proliferation; negative regulation of nitric-oxide synthase biosynthetic process; positive regulation of superoxide release; xenobiotic metabolic process; negative regulation of protein kinase activity; negative regulation of apoptosis