Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Parathyroid Hormone (PTH) Active Protein | PTH active protein

Recombinant Human Parathyroid Hormone (PTH)

Gene Names
PTH; PTH1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Parathyroid Hormone (PTH); Recombinant Human Parathyroid Hormone (PTH); Parathyroid Hormone; PTH; Parathormone; Parathyrin; PTH active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 10 mM HAc-NaAc, 150 mM NaCl, 5% Mannitol, pH 4.0
Sequence Positions
32-115aa; Full Length of Mature Protein
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Sequence Length
115
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to induce cAMP accumulation in MC3T3-E1 mouse preosteoblast cells is less than 0.1 ug/ml
Subcellular Location
Secreted
Protein Families
Parathyroid Hormone Family
Classification
Other Recombinant Protein
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for PTH active protein
Relevance: Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Another hormone, parathyroid hormone-related protein, binds to the same receptor as parathyroid hormone and has major effects on development. Like most other protein hormones, parathyroid hormone is synthesized as a preprohormone. After intracellular processing, the mature hormone is packaged within the Golgi into secretory vesicles, the secreted into blood by exocytosis. Parathyroid hormone is secreted as a linear protein of 84 amino acids.

Function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
Product Categories/Family for PTH active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9 kDa
NCBI Official Full Name
parathyroid hormone isoform 1 preproprotein
NCBI Official Synonym Full Names
parathyroid hormone
NCBI Official Symbol
PTH
NCBI Official Synonym Symbols
PTH1
NCBI Protein Information
parathyroid hormone
UniProt Protein Name
Parathyroid hormone
Protein Family
UniProt Gene Name
PTH
UniProt Synonym Gene Names
PTH
UniProt Entry Name
PTHY_HUMAN

NCBI Description

This gene encodes a member of the parathyroid family of proteins. The encoded preproprotein is proteolytically processed to generate a protein that binds to the parathyroid hormone/parathyroid hormone-related peptide receptor and regulates blood calcium and phosphate levels. Excess production of the encoded protein, known as hyperparathyroidism, can result in hypercalcemia and kidney stones. On the other hand, defective processing of the encoded protein may lead to hypoparathyroidism, which can result in hypocalcemia and numbness. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]

Uniprot Description

PTH: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2- deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH); also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism. Belongs to the parathyroid hormone family.

Protein type: Hormone; Secreted, signal peptide; Apoptosis; Secreted

Chromosomal Location of Human Ortholog: 11p15.3-p15.1

Cellular Component: extracellular space; extracellular region

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; type 1 parathyroid hormone receptor binding; parathyroid hormone receptor binding; peptide hormone receptor binding; hormone activity

Biological Process: response to drug; transcription from RNA polymerase II promoter; positive regulation of signal transduction; induction of apoptosis by hormones; positive regulation of glycogen biosynthetic process; negative regulation of transcription from RNA polymerase II promoter; positive regulation of bone mineralization; G-protein signaling, adenylate cyclase activating pathway; Rho protein signal transduction; cellular calcium ion homeostasis; G-protein coupled receptor protein signaling pathway; positive regulation of glucose import; response to cadmium ion; response to vitamin D; response to ethanol; cAMP metabolic process; cell-cell signaling; regulation of gene expression; response to lead ion; positive regulation of cAMP biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; skeletal development; bone resorption

Disease: Hypoparathyroidism, Familial Isolated

Research Articles on PTH

Similar Products

Product Notes

The PTH pth (Catalog #AAA7115159) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 32-115aa; Full Length of Mature Protein. The amino acid sequence is listed below: SVSEIQLMHN LGKHLNSMER VEWLRKKLQD VHNFVALGAP LAPRDAGSQR PRKKEDNVLV ESHEKSLGEA DKADVNVLTK AKSQ. It is sometimes possible for the material contained within the vial of "Parathyroid Hormone (PTH), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.