Interleukin-37 (IL37) Active Protein | IL37 active protein

Recombinant Human Interleukin-37 (IL37), Partial

Cat. Num. AAA7115040

• Gene Names: IL37; FIL1; FIL1Z; IL-1H; IL-37; IL1F7; IL1H4; IL-1F7; IL-1H4; IL1RP1; IL-1RP1; FIL1(ZETA)
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-37 (IL37); Recombinant Human Interleukin-37 (IL37); Partial; Interleukin-37; FIL1 Zeta; IL-1X; Interleukin-1 Family Member 7; IL-1F7; Interleukin-1 Homolog 4; IL-1H; IL-1H4; Interleukin-1 Zeta; IL-1 Zeta; Interleukin-1-Related Protein; IL-1RP1; Interleukin-23; IL-37; IL37; FIL1Z; IL1F7; IL1H4; IL1RP1; IL37 active protein

• Host: E Coli
• Specificity: In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis, colon, placenta, lung and lymph node. Isoform D and isoform E were found only in testis and bone marrow. Whereas only isoform A is found in brain, only isoform B in kidney and only isoform C in heart.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, 2 mM DTT, pH 7.4
• Sequence Positions: 53-218aa; Partial
• Sequence: KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
• Sequence Length: 192

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human IL-18R beta in functional ELISA is less than 10 ug/ml.
• Subcellular Location: Cytoplasm, Cytosol, Nucleus, Secreted
• Protein Families: IL-1 Family
• Classification: Cytokine
• Subdivision: Interleukin
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IL37 active protein

Relevance: Human Interleukin family 1 Member 7 (IL1F7) is a member of the Interleukin 1 cytokine family. Five alternatively spliced transcript variants encoding distinct isoforms have been reported with distinct expression profiles. The longest IL1F7 transcript, referred to as IL1F7b or IL1F7 isoform 1, encodes a 218 amino acid residues proprotein containing a 45 amino acid propeptide, which is cleaved to generate mature protein. IL1F7b binds to IL18 Ralpha with low affinity but does not exert any IL18 agonistic or antagonistic effects. IL1F7b also binds interleukin 18 binding protein (IL-18BP), an inhibitory binding protein of interleukin 18 (IL-18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL-18.

Function: Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.

Product Categories/Family for IL37 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 27894302
• NCBI GeneID: 27178
• NCBI Accession #: NP_775297.1
• NCBI GenBank Nucleotide #: NM_173205.1
• UniProt Accession #: Q9NZH6
• Molecular Weight: 18.7 kDa
• NCBI Official Full Name: interleukin-37 isoform 5
• NCBI Official Synonym Full Names: interleukin 37
• NCBI Official Symbol: IL37
• NCBI Official Synonym Symbols: FIL1; FIL1Z; IL-1H; IL-37; IL1F7; IL1H4; IL-1F7; IL-1H4; IL1RP1; IL-1RP1; FIL1(ZETA)
• NCBI Protein Information: interleukin-37
• UniProt Protein Name: Interleukin-37
• Protein Family: Interleukin
• UniProt Gene Name: IL37
• UniProt Synonym Gene Names: FIL1Z; IL1F7; IL1H4; IL1RP1; IL-1F7; IL-1H; IL-1H4; IL-1 zeta; IL-1RP1; IL-37
• UniProt Entry Name: IL37_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine can bind to, and may be a ligand for interleukin 18 receptor (IL18R1/IL-1Rrp). This cytokine also binds to interleukin 18 binding protein (IL18BP), an inhibitory binding protein of interleukin 18 (IL18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18. This gene along with eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Five alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

IL37: Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation. Belongs to the IL-1 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 2q12-q14.1

Cellular Component: nucleoplasm; extracellular space; cytoplasm; extracellular region; nucleolus; nucleus; cytosol

Molecular Function: interleukin-1 receptor binding; cytokine activity

Biological Process: cytokine and chemokine mediated signaling pathway; immune response; inflammatory response