Interleukin-37/IL-37 Recombinant Protein | IL-37 recombinant protein

Recombinant Human Interleukin-37/IL-37 Protein

Cat. Num. AAA9139842

• Gene Names: IL37; FIL1; FIL1Z; IL-1H; IL-37; IL1F7; IL1H4; IL-1F7; IL-1H4; IL1RP1; IL-1RP1; FIL1(ZETA)
• Purity: >95% by SDS-PAGE.
• Synonyms: Interleukin-37/IL-37; Recombinant Human Interleukin-37/IL-37 Protein; FIL1; FIL1(ZETA); FIL1Z; IL-1F7; IL-1H; IL-1H4; IL-1RP1; IL-37; IL1F7; IL1H4; IL1RP1; IL-37 recombinant protein

• Host: E Coli
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 um filtered solution of 20 mM PB, 150 mM NaCl, 2 mM DTT, pH 7.4.
• Sequence: KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
• Sequence Length: 192

• Species: Human
• Endotoxin: < 1 EU/ug of the protein by LAL method.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: No tag
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human Interleukin-37/IL-37 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 18 kDa.)

Related Product Information for IL-37 recombinant protein

Description: Recombinant Human Interleukin-37/IL-37 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys53-Asp218) of human Interleukin-37/IL-37 (Accession #Q9NZH6) fused with an initial Met at the N-terminus.

Background: This protein is a member of the interleukin 1 cytokine family. This cytokine can bind to, and may be a ligand for interleukin 18 receptor (IL18R1/IL-1Rrp). This cytokine also binds to interleukin 18 binding protein (IL18BP), an inhibitory binding protein of interleukin 18 (IL18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18. This gene along with eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Five alternatively spliced transcript variants encoding distinct isoforms have been reported.

Product Categories/Family for IL-37 recombinant protein

Cytokines & Cytokine Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 27894302
• NCBI GeneID: 27178
• NCBI Accession #: NP_775297.1
• NCBI GenBank Nucleotide #: NP_775297.1
• UniProt Accession #: Q9NZH6
• NCBI Official Full Name: interleukin-37 isoform 5
• NCBI Official Synonym Full Names: interleukin 37
• NCBI Official Symbol: IL37
• NCBI Official Synonym Symbols: FIL1; FIL1Z; IL-1H; IL-37; IL1F7; IL1H4; IL-1F7; IL-1H4; IL1RP1; IL-1RP1; FIL1(ZETA)
• NCBI Protein Information: interleukin-37
• UniProt Protein Name: Interleukin-37
• UniProt Gene Name: IL37
• UniProt Synonym Gene Names: FIL1Z; IL1F7; IL1H4; IL1RP1; IL-1F7; IL-1H; IL-1H4; IL-1 zeta; IL-1RP1; IL-37
• UniProt Entry Name: IL37_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine can bind to, and may be a ligand for interleukin 18 receptor (IL18R1/IL-1Rrp). This cytokine also binds to interleukin 18 binding protein (IL18BP), an inhibitory binding protein of interleukin 18 (IL18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18. This gene along with eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Five alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

IL37: Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation. Belongs to the IL-1 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 2q12-q14.1

Cellular Component: nucleoplasm; extracellular space; cytoplasm; extracellular region; nucleolus; nucleus; cytosol

Molecular Function: interleukin-1 receptor binding; cytokine activity

Biological Process: cytokine and chemokine mediated signaling pathway; immune response; inflammatory response