Interleukin-13 (Il13) Active Protein | Il13 active protein

Recombinant Mouse Interleukin-13 (Il13)

Cat. Num. AAA7115071

• Gene Names: Il13; Il-13
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-13 (Il13); Recombinant Mouse Interleukin-13 (Il13); Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13; Il13 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Sequence Positions: 22-131aa; Full Length of Mature Protein
• Sequence: PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
• Sequence Length: 131

• Species: Mouse
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 2 ng/ml.
• Subcellular Location: Secreted
• Protein Families: IL-4/IL-13 Family
• Classification: Cytokine
• Subdivision: Interleukin
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Il13 active protein

Relevance: Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13Ralpha1 with low affinity and triggers association of IL4Ralpha, generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13Ralpha2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disease.

Function: Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses (By similarity). Positively regulates IL31RA expression in macrophages.

Product Categories/Family for Il13 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 6680403
• NCBI GeneID: 16163
• NCBI Accession #: NP_032381.1
• NCBI GenBank Nucleotide #: NM_008355.3
• UniProt Accession #: P20109
• Molecular Weight: 12.2 kDa
• NCBI Official Full Name: interleukin-13
• NCBI Official Synonym Full Names: interleukin 13
• NCBI Official Symbol: Il13
• NCBI Official Synonym Symbols: Il-13
• NCBI Protein Information: interleukin-13
• UniProt Protein Name: Interleukin-13
• Protein Family: Interleukin
• UniProt Gene Name: Il13
• UniProt Synonym Gene Names: Il-13; IL-13
• UniProt Entry Name: IL13_MOUSE

Uniprot Description

IL13: Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Defects in IL13 may be a cause of susceptibility to allergic rhinitis (ALRH). Allergic rhinitis is a common disease of complex inheritance and is characterized by mucosal inflammation caused by allergen exposure. Belongs to the IL-4/IL-13 family.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Cellular Component: extracellular space; cytoplasm; extracellular region; external side of plasma membrane

Molecular Function: interleukin-13 receptor binding; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; cytokine activity

Biological Process: response to nicotine; positive regulation of smooth muscle cell proliferation; regulation of proton transport; microglial cell activation; positive regulation of mast cell degranulation; positive regulation of connective tissue growth factor production; positive regulation of tyrosine phosphorylation of Stat6 protein; positive regulation of immunoglobulin production; positive regulation of protein secretion; positive regulation of B cell proliferation; positive regulation of ion transport; immune response; positive regulation of release of sequestered calcium ion into cytosol; inflammatory response; negative regulation of NAD(P)H oxidase activity; positive regulation of macrophage activation