SDS-Page
(Recombinant protein Human IGF2 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 7 kDa.)
IGF2 active protein
Recombinant Human IGF2 Protein
Gene Names
IGF2; GRDF; IGF-II; PP9974; C11orf43
Purity
>95% by SDS-PAGE.
Synonyms
IGF2; Recombinant Human IGF2 Protein; C11orf43; GRDF; IGF-II; PP9974; IGF2 active protein
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 5 mM Hac, pH 3.0.
Sequence
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Sequence Length
180
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Biological Activity
Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 1.5-6 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant protein Human IGF2 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 7 kDa.)
SDS-Page
(Recombinant protein Human IGF2 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 7 kDa.)
Related Product Information for IGF2 active protein
Description: Recombinant Human IGF2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala25-Glu91) of human IGF2 (Accession #P01344).
Background: This protein belongs a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Background: This protein belongs a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for IGF2 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Insulin-like growth factor II
NCBI Official Synonym Full Names
insulin like growth factor 2
NCBI Official Symbol
IGF2
NCBI Official Synonym Symbols
GRDF; IGF-II; PP9974; C11orf43
NCBI Protein Information
insulin-like growth factor II
UniProt Protein Name
Insulin-like growth factor II
Protein Family
UniProt Gene Name
IGF2
UniProt Synonym Gene Names
IGF-II
UniProt Entry Name
IGF2_HUMAN
NCBI Description
This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]
Research Articles on IGF2
Similar Products
Product Notes
The IGF2 igf2 (Catalog #AAA9139821) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AYRPSETLCG GELVDTLQFV CGDRGFYFSR PASRVSRRSR GIVEECCFRS CDLALLETYC ATPAKSE. It is sometimes possible for the material contained within the vial of "IGF2, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
