Fibronectin (FN1) Active Protein | FN1 active protein

Recombinant Human Fibronectin (FN1), Partial

Cat. Num. AAA7115172

• Gene Names: FN1; FN; CIG; FNZ; MSF; ED-B; FINC; GFND; LETS; GFND2; SMDCF
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Fibronectin (FN1); Recombinant Human Fibronectin (FN1); Partial; NovoNectin; Fibronectin; FN; Cold-insoluble globulin; CIG; Fibronectin 1; FN1 active protein

• Host: E Coli
• Specificity: Plasma FN (soluble dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. Ugl-Y1, Ugl-Y2 and Ugl-Y3 are found in urine.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 12.5 mM Sodium Citrate, 1.25% Sucrose, pH 6.2
• Sequence Positions: 1270-1546aa & 1721-2016aa; Dimer
• Sequence: PTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPS & AIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITIS WRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST
• Sequence Length: 2355

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: Specific activity as determined by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells is greater than 50%. When 1×10^5 cells/well are added to plates coated with fibronectin (7-13 ng/mL and 100muL/well),approximately 50%-80% will adhere specifically after 30 minutes at 37 degree C.
• Subcellular Location: Secreted, Extracellular Space, Extracellular Matrix
• Classification: Other Recombinant Protein
• Pathway: PI3K-Akt Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for FN1 active protein

Relevance: Fibronectin1(FN1) is a secreted protein and contains 12 fibronectin type-I domains, fibronectin type-II domains and 16 fibronectin type-III domains. Recombinant human fibronectin fragment, is a protein of ~63 kDa containing a central cell-binding domain, a high affinity heparin-binding domain II, and CS1 site within the alternatively spliced III CS region of human fibronectin. Cells bind to a VLA-4 ligand, a CS-I site, and a VLA-5 ligand, a cell attachment domain, and virus vectors binds to a heparin binding domain II, which co-locates the cell and the virus vector on NovoNectin. This process enhances the density of both cells and vectors, and facilitates the gene transduction in the result.

Function: Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization. Participates in the regulation of type I collagen deposition by osteoblasts.

Product Categories/Family for FN1 active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 16933542
• NCBI GeneID: 2335
• NCBI Accession #: NP_002017.1
• NCBI GenBank Nucleotide #: NM_002026.3
• UniProt Accession #: P02751
• Molecular Weight: 62.7 kDa
• NCBI Official Full Name: fibronectin isoform 3 preproprotein
• NCBI Official Synonym Full Names: fibronectin 1
• NCBI Official Symbol: FN1
• NCBI Official Synonym Symbols: FN; CIG; FNZ; MSF; ED-B; FINC; GFND; LETS; GFND2; SMDCF
• NCBI Protein Information: fibronectin
• UniProt Protein Name: Fibronectin
• Protein Family: Fibronectin
• UniProt Gene Name: FN1
• UniProt Synonym Gene Names: FN; FN; CIG
• UniProt Entry Name: FINC_HUMAN

NCBI Description

This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. The encoded preproprotein is proteolytically processed to generate the mature protein. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing. The full-length nature of some variants has not been determined. [provided by RefSeq, Jan 2016]

Uniprot Description

FN1: Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Defects in FN1 are the cause of glomerulopathy with fibronectin deposits type 2 (GFND2); also known as familial glomerular nephritis with fibronectin deposits or fibronectin glomerulopathy. GFND is a genetically heterogeneous autosomal dominant disorder characterized clinically by proteinuria, microscopic hematuria, and hypertension that leads to end-stage renal failure in the second to fifth decade of life. 15 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide; Motility/polarity/chemotaxis; Cell adhesion

Chromosomal Location of Human Ortholog: 2q34

Cellular Component: extracellular matrix; extracellular space; apical plasma membrane; fibrinogen complex; extracellular region; ER-Golgi intermediate compartment; basal lamina

Molecular Function: heparin binding; collagen binding; integrin binding; protein binding; protease activator activity; protease binding

Biological Process: integrin activation; platelet activation; extracellular matrix organization and biogenesis; positive regulation of axon extension; extracellular matrix disassembly; regulation of cell shape; platelet degranulation; acute-phase response; calcium-independent cell-matrix adhesion; cell-substrate junction assembly; response to wounding; peptide cross-linking; angiogenesis; cell adhesion; blood coagulation; leukocyte migration

Disease: Glomerulopathy With Fibronectin Deposits 2; Plasma Fibronectin Deficiency