Fibroblast Growth Factor 4 (FGF4) Active Protein | FGF4 active protein
Recombinant Human Fibroblast Growth Factor 4 (FGF4), Partial
Gene Names
FGF4; HST; KFGF; FGF-4; HST-1; HSTF1; K-FGF; HBGF-4; HSTF-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibroblast Growth Factor 4 (FGF4); Recombinant Human Fibroblast Growth Factor 4 (FGF4); Partial; Fibroblast growth factor 4; FGF-4; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; FGF4; HSTF1; KS3; FGF4 active protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
Sequence Positions
54-206aa; Partial
Sequence
SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Sequence Length
206
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 10 ng/ml.
Subcellular Location
Secreted
Protein Families
Heparin-Binding Growth Factors Family
Classification
Cytokine
Subdivision
Growth Factor
Pathway
MAPK Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for FGF4 active protein
Relevance: Fibroblast growth factor 4(FGF-4) is a heparin binding member of the FGF family. The human FGF4 cDNA encodes 206 amino acids (aa) with a 33 aa signal sequence and a 173 aa mature protein with an FGF homology domain that contains a heparin binding region near the C-terminus. Mature human FGF4 shares 91%, 82%, 94% and 91% aa identity with mouse, rat, canine and bovine FGF4, respectively. Human FGF-4 has been shown to exhibit cross species activity. Expression of FGF-4 and its receptors, FGF R1c, 2c, 3c and 4, is spatially and temporally regulated during embryonic development. FGF-4 is proposed to play a physiologically relevant role in human embryonic stem cell selfrenewal. It promotes stem cell proliferation, but may also aid differentiation depending on context and concentration, and is often included in embryonic stem cell media in vitro. FGF-4 is mitogenic for fibroblasts and endothelial cells in vitro and has autocrine transforming potential. It is a potent angiogenesis promoter in vivo and has been investigated as therapy for coronary artery disease.
Function: Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.
Function: Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.
Product Categories/Family for FGF4 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.9 kDa
NCBI Official Full Name
fibroblast growth factor 4
NCBI Official Synonym Full Names
fibroblast growth factor 4
NCBI Official Symbol
FGF4
NCBI Official Synonym Symbols
HST; KFGF; FGF-4; HST-1; HSTF1; K-FGF; HBGF-4; HSTF-1
NCBI Protein Information
fibroblast growth factor 4
UniProt Protein Name
Fibroblast growth factor 4
Protein Family
UniProt Gene Name
FGF4
UniProt Synonym Gene Names
HST; HSTF1; KS3; FGF-4; HST; HST-1; HSTF-1; HBGF-4
UniProt Entry Name
FGF4_HUMAN
NCBI Description
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its oncogenic transforming activity. This gene and FGF3, another oncogenic growth factor, are located closely on chromosome 11. Co-amplification of both genes was found in various kinds of human tumors. Studies on the mouse homolog suggested a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway. [provided by RefSeq, Jul 2008]
Uniprot Description
Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.
Research Articles on FGF4
Similar Products
Product Notes
The FGF4 fgf4 (Catalog #AAA7114995) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 54-206aa; Partial. The amino acid sequence is listed below: SLARLPVAAQ PKEAAVQSGA GDYLLGIKRL RRLYCNVGIG FHLQALPDGR IGGAHADTRD SLLELSPVER GVVSIFGVAS RFFVAMSSKG KLYGSPFFTD ECTFKEILLP NNYNAYESYK YPGMFIALSK NGKTKKGNRV SPTMKVTHFL PRL. It is sometimes possible for the material contained within the vial of "Fibroblast Growth Factor 4 (FGF4), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
