Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Fibroblast Growth Factor 2 (Fgf2) Active Protein | Fgf2 active protein

Recombinant Rat Fibroblast Growth Factor 2 (Fgf2), Partial

Gene Names
Fgf2; bFGF; Fgf-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibroblast Growth Factor 2 (Fgf2); Recombinant Rat Fibroblast Growth Factor 2 (Fgf2); Partial; Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB; Fgf2 active protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
Found in all tissues examined.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
Sequence Positions
11-154aa; Partial
Sequence
ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Sequence Length
154
Species
Rat
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 5 ng/ml.
Subcellular Location
Secreted, Nucleus
Protein Families
Heparin-Binding Growth Factors Family
Classification
Cytokine
Subdivision
Growth Factor
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Fgf2 active protein
Relevance: FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family. The family constitutes a large family of proteins involved in many aspects of development including cell proliferation, growth, and differentiation. They act on several cell types to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects, and tissue repair. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4.

Function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis.
Product Categories/Family for Fgf2 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.2 kDa
NCBI Official Full Name
fibroblast growth factor 2
NCBI Official Synonym Full Names
fibroblast growth factor 2
NCBI Official Symbol
Fgf2
NCBI Official Synonym Symbols
bFGF; Fgf-2
NCBI Protein Information
fibroblast growth factor 2
UniProt Protein Name
Fibroblast growth factor 2
Protein Family
UniProt Gene Name
Fgf2
UniProt Synonym Gene Names
Fgf-2; FGF-2; bFGF; HBGF-2
UniProt Entry Name
FGF2_RAT

NCBI Description

activates the MAP kinase signaling pathway; plays a role in synaptic transmission; induces cell proliferation [RGD, Feb 2006]

Uniprot Description

FGF2: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors. Interacts with CSPG4, FGFBP1 and TEC. Found in a complex with FGFBP1, FGF1 and FGF2. Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non- cancerous liver tissue. Belongs to the heparin-binding growth factors family. 4 isoforms of the human protein are produced by alternative initiation.

Protein type: Motility/polarity/chemotaxis; Activator

Cellular Component: extracellular space; cytoplasm; cytosol; nucleus

Molecular Function: heparin binding; protein binding; ligand-dependent nuclear receptor transcription coactivator activity; growth factor activity; cytokine activity; chemoattractant activity; fibroblast growth factor receptor binding

Biological Process: wound healing; activation of MAPKK activity; regulation of cell cycle; positive regulation of transcription, DNA-dependent; positive regulation of smooth muscle cell proliferation; adrenocorticotropin hormone secreting cell differentiation; thyroid stimulating hormone secreting cell differentiation; hyaluronan catabolic process; growth factor dependent regulation of satellite cell proliferation; negative regulation of cell proliferation; embryonic development ending in birth or egg hatching; positive regulation of MAP kinase activity; glial cell differentiation; substantia nigra development; positive chemotaxis; induction of an organ; positive regulation of cell proliferation; regulation of retinal cell programmed cell death; angiogenesis; response to axon injury; aging; positive regulation of cardiac muscle cell proliferation; positive regulation of granule cell precursor proliferation; fibroblast growth factor receptor signaling pathway; positive regulation of cell fate specification; positive regulation of blood vessel endothelial cell migration; positive regulation of phosphoinositide 3-kinase activity; negative regulation of blood vessel endothelial cell migration; positive regulation of protein kinase B signaling cascade; positive regulation of osteoblast differentiation; stem cell development; positive regulation of angiogenesis; cell migration during sprouting angiogenesis; ureteric bud branching; release of sequestered calcium ion into cytosol; positive regulation of cell division; phosphatidylinositol biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; positive regulation of endothelial cell proliferation; positive regulation of protein amino acid phosphorylation; positive regulation of cell differentiation; inositol phosphate biosynthetic process; positive regulation of epithelial cell proliferation; lung development

Research Articles on Fgf2

Similar Products

Product Notes

The Fgf2 fgf2 (Catalog #AAA7115014) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 11-154aa; Partial. The amino acid sequence is listed below: ALPEDGGGAF PPGHFKDPKR LYCKNGGFFL RIHPDGRVDG VREKSDPHVK LQLQAEERGV VSIKGVCANR YLAMKEDGRL LASKCVTEEC FFFERLESNN YNTYRSRKYS SWYVALKRTG QYKLGSKTGP GQKAILFLPM SAKS. It is sometimes possible for the material contained within the vial of "Fibroblast Growth Factor 2 (Fgf2), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.