Carbonic Anhydrase-Related (CA8) Active Protein | CA8 active protein

Recombinant Human Carbonic Anhydrase-Related Protein (CA8), Partial

Cat. Num. AAA7115139

• Gene Names: CA8; CALS; CARP; CA-RP; CAMRQ3; CA-VIII
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Carbonic Anhydrase-Related (CA8); Recombinant Human Carbonic Anhydrase-Related Protein (CA8); Partial; Carbonic Anhydrase-Related Protein; CARP; Carbonic Anhydrase VIII; CA-VIII; CA8; CALS; CA8 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: 0.2 mum Filtered 20 mM Tris-HCl, 500 mM NaCl, 1 mM DTT, pH 8.5
• Sequence Positions: 2-290aa; Partial
• Sequence: ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
• Sequence Length: 290

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The esterase activity is determined to be greater than 100 pmol/min/ug
• Protein Families: Alpha-Carbonic Anhydrase Family
• Classification: Other Recombinant Protein
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for CA8 active protein

Relevance: Carbonic Anhydrase 8 (CA8) belongs to the alpha-carbonic anhydrase family. Alpha-carbonic anhydrase is a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. Because CA8 has some sequence similarity with other known carbonic anhydrase genes, it was firstly called as CA-related protein. Nevertheless, CA8 does not have a carbonic anhydrase catalytic activity. Defects in CA8 are the cause of cerebellar ataxia mental retardation and dysequilibrium syndrome type 3 (CMARQ3), which is a congenital cerebellar ataxia associated with dysarthia, quadrupedal gait and mild mental retardation.

Function: Does not have a carbonic anhydrase catalytic activity.

Product Categories/Family for CA8 active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 22027500
• NCBI GeneID: 767
• NCBI Accession #: NP_004047.3
• NCBI GenBank Nucleotide #: NM_004056.6
• UniProt Accession #: P35219
• Molecular Weight: 34.04 kDa
• NCBI Official Full Name: carbonic anhydrase-related protein isoform a
• NCBI Official Synonym Full Names: carbonic anhydrase 8
• NCBI Official Symbol: CA8
• NCBI Official Synonym Symbols: CALS; CARP; CA-RP; CAMRQ3; CA-VIII
• NCBI Protein Information: carbonic anhydrase-related protein
• UniProt Protein Name: Carbonic anhydrase-related protein
• Protein Family: Carbonic anhydrase-related protein
• UniProt Gene Name: CA8
• UniProt Synonym Gene Names: CALS; CARP; CA-VIII
• UniProt Entry Name: CAH8_HUMAN

NCBI Description

The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form. Mutations in this gene are associated with cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3). Polymorphisms in this gene are associated with osteoporosis, and overexpression of this gene in osteosarcoma cells suggests an oncogenic role. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Uniprot Description

CA8: Does not have a carbonic anhydrase catalytic activity. Defects in CA8 are the cause of cerebellar ataxia mental retardation and dysequilibrium syndrome type 3 (CMARQ3). CMARQ3 is a congenital cerebellar ataxia associated with dysarthia, quadrupedal gait and mild mental retardation. Belongs to the alpha-carbonic anhydrase family.

Protein type: Energy Metabolism - nitrogen; Lyase

Chromosomal Location of Human Ortholog: 8q12.1

Cellular Component: cytoplasm

Molecular Function: carbonate dehydratase activity; zinc ion binding

Biological Process: phosphoinositide-mediated signaling; one-carbon compound metabolic process

Disease: Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 3