Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Carbonic Anhydrase 5B (CA5B) Active Protein | CA5B active protein

Recombinant Human Carbonic Anhydrase 5B, Mitochondrial (CA5B)

Gene Names
CA5B; CAVB; CA-VB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carbonic Anhydrase 5B (CA5B); Recombinant Human Carbonic Anhydrase 5B; Mitochondrial (CA5B); Carbonic Anhydrase 5B Mitochondrial; Carbonate Dehydratase VB; Carbonic Anhydrase VB; CA-VB; CA5B; CA5B active protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
Strongest expression in heart, pancreas, kidney, placenta, lung, and skeletal muscle. Not expressed in liver.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
0.2 mum Filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.0
Sequence Positions
34-317aa; Full Length of Mature Protein
Sequence
CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Sequence Length
317
Species
Human
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The esterase activity is determined to be greater than 1000 pmol/min/ug
Subcellular Location
Mitochondrion
Protein Families
Alpha-Carbonic Anhydrase Family
Classification
Other Recombinant Protein
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CA5B active protein
Relevance: Carbonic Anhydrase 5B (CA5B) is a member of alpha-carbonic anhydrase family (CAs) that catalyze the reversible hydration of carbon dioxide. CAs is associated with many biological processes, including calcification, respiration, bone resorption, acid-base balance and the formation of aqueous humor. CA5B is highly expressed in heart, pancreas, kidney, placenta, lung, and skeletal muscle, but it is restricted to the liver. CA5B is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA-VA. CA5B is inhibited by coumarins, sulfonamide derivatives such as acetazolamide (AZA), saccharin, and Foscarnet.

Function: Reversible hydration of carbon dioxide.
Product Categories/Family for CA5B active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.77 kDa
NCBI Official Full Name
carbonic anhydrase 5B, mitochondrial
NCBI Official Synonym Full Names
carbonic anhydrase 5B
NCBI Official Symbol
CA5B
NCBI Official Synonym Symbols
CAVB; CA-VB
NCBI Protein Information
carbonic anhydrase 5B, mitochondrial
UniProt Protein Name
Carbonic anhydrase 5B, mitochondrial
Protein Family
UniProt Gene Name
CA5B
UniProt Synonym Gene Names
CA-VB
UniProt Entry Name
CAH5B_HUMAN

NCBI Description

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes carbonic anhydrase 5B. CA5B, and the related CA5A gene, has its expression localized in the mitochondria though CA5B has a wider tissue distribution than CA5A, which is restricted to the liver, kidneys, and skeletal muscle. A carbonic anhydrase pseudogene (CA5BP1) is adjacent to the CA5B gene and these two loci produce CA5BP1-CA5B readthrough transcripts. [provided by RefSeq, Jan 2019]

Uniprot Description

CA5B: Reversible hydration of carbon dioxide. Belongs to the alpha-carbonic anhydrase family.

Protein type: Lyase; Energy Metabolism - nitrogen; EC 4.2.1.1; Mitochondrial

Chromosomal Location of Human Ortholog: Xp21.1

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: carbonate dehydratase activity; zinc ion binding

Biological Process: bicarbonate transport; one-carbon compound metabolic process

Research Articles on CA5B

Similar Products

Product Notes

The CA5B ca5b (Catalog #AAA7115161) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 34-317aa; Full Length of Mature Protein. The amino acid sequence is listed below: CSLYTCTYKT RNRALHPLWE SVDLVPGGDR QSPINIRWRD SVYDPGLKPL TISYDPATCL HVWNNGYSFL VEFEDSTDKS VIKGGPLEHN YRLKQFHFHW GAIDAWGSEH TVDSKCFPAE LHLVHWNAVR FENFEDAALE ENGLAVIGVF LKLGKHHKEL QKLVDTLPSI KHKDALVEFG SFDPSCLMPT CPDYWTYSGS LTTPPLSESV TWIIKKQPVE VDHDQLEQFR TLLFTSEGEK EKRMVDNFRP LQPLMNRTVR SSFRHDYVLN VQAKPKPATS QATP. It is sometimes possible for the material contained within the vial of "Carbonic Anhydrase 5B (CA5B), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.