Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (SDS-PAGE analysis of recombinant rat soluble Podoplanin. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Silver stain.)

Podoplanin, soluble Active Protein | Pdpn active protein

Rat Podoplanin, soluble

Gene Names
Pdpn; E11; Gp38; OTS-8; RTI40; T1-alpha
Reactivity
Rat
Purity
> 98% by SDS-PAGE & silver stain
Synonyms
Podoplanin; soluble; Rat Podoplanin; Recombinant Rat soluble Podoplanin; Gp38; Glycoprotein 38; Ots8; T1-alpha; Pdpn active protein
Ordering
For Research Use Only!
Host
E Coli
Reactivity
Rat
Purity/Purification
> 98% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
GAIGALEDDLVTPGPGDDMVNPGLEDRIETTDTTGELDKSTAKAPLVPTQPPIEELPTSGTSDHDHKEHESTTTVKAVTSHSTDKKTTHPNRDNAGGETQTTDKKDGLAVVTLEHHHHHH
Sequence Length
120
N Terminal Sequence
GAIGALED
Buffer
0.5x PBS
Biological Activity
Not tested so far.
Preparation and Storage
Stability: The lyophilized protein is stable for a few weeks at room temperature, but best stored at –20 degree C. Reconstituted soluble Podoplanin should be stored in working aliquots at –20 degree C.

Reconstitution: We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4 degree C for 1 week or -20 degree C for future use.
Avoid freeze/thaw cycles.

Testing Data

(SDS-PAGE analysis of recombinant rat soluble Podoplanin. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Silver stain.)

Testing Data (SDS-PAGE analysis of recombinant rat soluble Podoplanin. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Silver stain.)
Related Product Information for Pdpn active protein
Podoplanin, also known as glycoprotein 38 (gp38), PA2.26 antigen, T1alpha (T1A), and aggrus, is a 38 kDa type I transmembrane sialoglycoprotein and member of the podoplanin family. Podoplanin is synthesized as a 172 amino acid (aa) precursor with a 22 aa signal sequence, a 119 aa extracellular domain (ECD), a 21 aa transmembrane region, and a short, 10 aa cytoplasmic tail. The ECD contains abundant Ser/Thr residues as potential sites for Oglycosylation, and the cytoplasmic region contains putative sites for kinase C and cAMP phosphorylation. Mouse Podoplanin shares 77% and 46% aa sequence identity with rat and human Podoplanin, respectively. Podoplanin is expressed on glomerular epithelial cells (podocytes), type I lung alveolar cells, lymphatic endothelial cells, and on numerous tumors including colorectal tumors, squamous cell carcinomas, testicular seminoma, and brain tumors. One study shows high expression of Podoplanin mRNA in placenta, lung, skeletal muscle, and heart, and weaker levels in brain, kidney, and liver. Podoplanin is the ligand for Ctype lectin like receptor 2 (CLEC2). Their association is dependent on sialic acid on Oglycans of Podoplanin. Through its association with CLEC2, Podoplanin induces platelet aggregation and tumor metastasis. Podoplanin is also necessary for lymphatic vessel formation, normal lung cell proliferation and alveolus formation at birth.
Product Categories/Family for Pdpn active protein
References
1. Zimmer et al, Biochem J 341:277, 1999 2. KatsueInoue et al, J Biol Chem 282:25993, 2007 3. Kato et al, J Biol Chem 278:51599, 2003 4. Schacht et al, Am J Pathol 166:913, 2005 5. Breiteneder-Geleff et al, Am J Pathol 151:1141, 1997 6. Kato et al, Tumour Biol 26:195, 2005 7. Kato et al, Oncogene 23:8552, 2004 8. Mishima et al, Acta Neuropathol 111:563, 2006 9. Mishima et al, Acta Neuropathol 111:483, 2006 10. Kato et al, Biochem Biophys Res Commun 349:1301, 2006

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,8 kDa
NCBI Official Full Name
podoplanin
NCBI Official Synonym Full Names
podoplanin
NCBI Official Symbol
Pdpn
NCBI Official Synonym Symbols
E11; Gp38; OTS-8; RTI40; T1-alpha
NCBI Protein Information
podoplanin; T1A; RTI140; glycoprotein 38; E11 antigen epitope; type I cell 40 kDa protein; epithelial cell surface transmembrane protein antigen; pulmonary type I alveolar epithelial cell transmembrane differentiation marker
UniProt Protein Name
Podoplanin
Protein Family
UniProt Gene Name
Pdpn
UniProt Synonym Gene Names
Gp38; Ots8; Gp38; T1A
UniProt Entry Name
PDPN_RAT

NCBI Description

membrane glycoprotein that may function in lung development [RGD, Feb 2006]

Uniprot Description

Function: May be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. Required for normal lung cell proliferation and alveolus formation at birth. Induces platelet aggregation. Does not have any effect on folic acid or amino acid transport. Does not function as a water channel or as a regulator of aquaporin-type water channels

By similarity.

Subcellular location: Membrane; Single-pass type I membrane protein. Cell projection › lamellipodium membrane; Single-pass type I membrane protein. Cell projection › filopodium membrane; Single-pass type I membrane protein. Cell projection › microvillus membrane; Single-pass type I membrane protein. Cell projection › ruffle membrane; Single-pass type I membrane protein. Note: Localized to actin-rich microvilli and plasma membrane projections such as filopodia, lamellipodia and ruffles. Ref.3

Tissue specificity: In adult kidney, expressed on the urinary surface and foot processes of podocytes and in parietal epithelial cells of Bowman's capsule where it is localized to luminal surfaces. In lung, expressed exclusively on luminal surfaces of type I alveolar epithelial cells and pleural mesothelial cells. Not expressed in type II alveolar cells. In bone, expressed in osteocytes and osteoblasts. In spleen, liver, stomach and intestine, expressed in mesoepithelium. Also expressed in thymic epithelial cells, choroid plexus and leptomeninges. Ref.3 Ref.4

Developmental stage: In newborn kidney, not detected at the vesicle stage. First detected in S-shaped bodies. Ref.3

Post-translational modification: Extensively O-glycosylated. Contains sialic acid residues. O-glycosylation is necessary for platelet aggregation activity. Ref.6The N-terminus is blocked.

Miscellaneous: Down-regulated in puromycin aminonucleoside nephrosis (PAN).

Sequence similarities: Belongs to the podoplanin family.

Research Articles on Pdpn

Similar Products

Product Notes

The Pdpn pdpn (Catalog #AAA692151) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Rat Podoplanin, soluble reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: GAIGALEDDL VTPGPGDDMV NPGLEDRIET TDTTGELDKS TAKAPLVPTQ PPIEELPTSG TSDHDHKEHE STTTVKAVTS HSTDKKTTHP NRDNAGGETQ TTDKKDGLAV VTLEHHHHHH. It is sometimes possible for the material contained within the vial of "Podoplanin, soluble, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.