Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C-X-C Motif Chemokine 5 (CXCL5) Active Protein | CXCL5 active protein

Recombinant Human C-X-C Motif Chemokine 5 (CXCL5), Partial

Gene Names
CXCL5; SCYB5; ENA-78
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-X-C Motif Chemokine 5 (CXCL5); Recombinant Human C-X-C Motif Chemokine 5 (CXCL5); Partial; C-X-C Motif Chemokine 5; ENA-78 (1-78); Epithelial-Derived Neutrophil-Activating Protein 78; Neutrophil-Activating Peptide ENA-78; Small-Inducible Cytokine B5; ENA-78 (8-78); ENA-78 (9-78); CXCL5; ENA78; SCYB5; CXCL5 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, pH 6.0
Sequence Positions
44-114aa; Partial
Sequence
LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Sequence Length
114
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 15 ng/mL.
Subcellular Location
Secreted
Protein Families
Intercrine alpha (chemokine CxC) Family
Classification
Cytokine
Subdivision
Chemokine
Pathway
Chemokine Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CXCL5 active protein
Relevance: C-X-C Motif Chemokine 5 (CXCL5) is a member of the Intercrine Alpha (Chemokine CXC) family. CXCL5 can be cleaved into the following two chains, ENA-78 (8-78) and ENA-78 (9-78). In vitro, ENA-78(8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. CXCL5 is a secreted protein and exercises the functions primarily through interactions with CXCR2. The upregulation of CXCL5 contributes to increased vascularization, tumor grown, and metastasis in many cancers.

Function: Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.
Product Categories/Family for CXCL5 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
7.95 kDa
NCBI Official Full Name
ENA-78
NCBI Official Synonym Full Names
C-X-C motif chemokine ligand 5
NCBI Official Symbol
CXCL5
NCBI Official Synonym Symbols
SCYB5; ENA-78
NCBI Protein Information
C-X-C motif chemokine 5
UniProt Protein Name
C-X-C motif chemokine 5
Protein Family
UniProt Gene Name
CXCL5
UniProt Synonym Gene Names
ENA78; SCYB5
UniProt Entry Name
CXCL5_HUMAN

NCBI Description

This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. [provided by RefSeq, May 2013]

Uniprot Description

CXCL5: Involved in neutrophil activation. In vitro, ENA-78(8- 78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: extracellular space; extracellular region

Molecular Function: chemokine activity; CXCR chemokine receptor binding

Biological Process: G-protein coupled receptor protein signaling pathway; cell-cell signaling; positive regulation of cell proliferation; neutrophil mediated immunity; response to lipopolysaccharide; positive regulation of leukocyte chemotaxis; immune response; inflammatory response; chemotaxis; signal transduction

Research Articles on CXCL5

Similar Products

Product Notes

The CXCL5 cxcl5 (Catalog #AAA7114953) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 44-114aa; Partial. The amino acid sequence is listed below: LRELRCVCLQ TTQGVHPKMI SNLQVFAIGP QCSKVEVVAS LKNGKEICLD PEAPFLKKVI QKILDGGNKE N. It is sometimes possible for the material contained within the vial of "C-X-C Motif Chemokine 5 (CXCL5), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.