C-X-C motif chemokine 5 Recombinant Protein | CXCL5 recombinant protein

Recombinant Human C-X-C motif chemokine 5 protein

Cat. Num. AAA717247

• Gene Names: CXCL5; SCYB5; ENA-78
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-X-C motif chemokine 5; Recombinant Human C-X-C motif chemokine 5 protein; ENA-78(1-78); Epithelial-derived neutrophil-activating protein 78; Neutrophil-activating peptide ENA-78; Small-inducible cytokine B5; CXCL5 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 37-110aa; Partial
• Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG
• Sequence Length: 114

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CXCL5 recombinant protein

Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chotactic activity for neutrophil granulocytes.

Product Categories/Family for CXCL5 recombinant protein

Immunology

References

Cloning of a full-length cDNA encoding the neutrophil-activating peptide ENA-78 from human platelets.Power C.A., Furness R.B., Brawand C., Wells T.N.C.Gene 151:333-334(1994) Cloning and characterization of the human neutrophil-activating peptide (ENA-78) gene.Chang M.S., McNinch J., Basu R., Simonet S.J. Biol. Chem. 269:25277-25282(1994) Characterization of the gene for human neutrophil-activating peptide 78 (ENA-78) .Corbett M.S., Schmitt I., Riess O., Walz A.Biochem. Biophys. Res. Commun. 205:612-617(1994) Localization of distal regulatory domains in the megakaryocyte-specific platelet basic protein/platelet factor 4 gene locus.Zhang C., Thornton M.A., Kowalska M.A., Sachis B.S., Feldman M., Poncz M., McKenzie S.E., Reilly M.P.Blood 98:610-617(2001) Novel polymorphism in ENA-78 gene.Amoli M.M., Thomson W., Hajeer A.H., Gonzalez-Gay M.A., Ollier W.E.R.Structure and neutrophil-activating properties of a novel inflammatory peptide (ENA-78) with homology to interleukin 8.Walz A., Burgener R., Car B., Baggiolini M., Kunkel S.L., Strieter R.M.J. Exp. Med. 174:1355-1362(1991) Isolation of the CXC chemokines ENA-78, GRO alpha and GRO gamma from tumor cells and leukocytes reveals NH2-terminal heterogeneity. Functional comparison of different natural isoforms.Wuyts A., Govaerts C., Struyf S., Lenaerts J.-P., Put W., Conings R., Proost P., Van Damme J.Eur. J. Biochem. 260:421-429(1999) Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.Nat. Biotechnol. 21:566-569(2003) Regulation of the immune response by the interaction of chemokines and proteases.Struyf S., Proost P., Van Damme J.Adv. Immunol. 81:1-44(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 4506849
• NCBI GeneID: 6374
• NCBI Accession #: NP_002985.1
• NCBI GenBank Nucleotide #: NM_002994.4
• UniProt Accession #: P42830; Q96QE1
• Molecular Weight: 34.9 kDa
• NCBI Official Full Name: C-X-C motif chemokine 5
• NCBI Official Synonym Full Names: chemokine (C-X-C motif) ligand 5
• NCBI Official Symbol: CXCL5
• NCBI Official Synonym Symbols: SCYB5; ENA-78
• NCBI Protein Information: C-X-C motif chemokine 5
• UniProt Protein Name: C-X-C motif chemokine 5
• Protein Family: C-X-C motif chemokine
• UniProt Gene Name: CXCL5
• UniProt Synonym Gene Names: ENA78; SCYB5
• UniProt Entry Name: CXCL5_HUMAN

NCBI Description

This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. [provided by RefSeq, May 2013]

Uniprot Description

CXCL5: Involved in neutrophil activation. In vitro, ENA-78(8- 78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: extracellular region; extracellular space

Molecular Function: chemokine activity; CXCR chemokine receptor binding

Biological Process: cell-cell signaling; chemotaxis; G-protein coupled receptor protein signaling pathway; immune response; inflammatory response; positive regulation of cell proliferation; positive regulation of leukocyte chemotaxis; response to lipopolysaccharide; signal transduction