Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Beta-1 adrenergic receptor (ADRB1) Recombinant Protein | ADRB1 recombinant protein

Recombinant Human Beta-1 adrenergic receptor (ADRB1)

Gene Names
ADRB1; RHR; B1AR; ADRB1R; BETA1AR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-1 adrenergic receptor (ADRB1); Recombinant Human Beta-1 adrenergic receptor (ADRB1); ADRB1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
378-477aa; Partial
Sequence
CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

SDS-Page

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
153
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12.5 kDa
NCBI Official Full Name
beta-1 adrenergic receptor
NCBI Official Synonym Full Names
adrenoceptor beta 1
NCBI Official Symbol
ADRB1
NCBI Official Synonym Symbols
RHR; B1AR; ADRB1R; BETA1AR
NCBI Protein Information
beta-1 adrenergic receptor
UniProt Protein Name
Beta-1 adrenergic receptor
UniProt Gene Name
ADRB1
UniProt Synonym Gene Names
ADRB1R; B1AR; Beta-1 adrenoceptor

NCBI Description

The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. [provided by RefSeq, Jul 2008]

Uniprot Description

Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.

Research Articles on ADRB1

Similar Products

Product Notes

The ADRB1 adrb1 (Catalog #AAA1236894) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 378-477aa; Partial. The amino acid sequence is listed below: CRSPDFRKAF QRLLCCARRA ARRRHATHGD RPRASGCLAR PGPPPSPGAA SDDDDDDVVG ATPPARLLEP WAGCNGGAAA DSDSSLDEPC RPGFASESKV . It is sometimes possible for the material contained within the vial of "Beta-1 adrenergic receptor (ADRB1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.