C-X-C Motif Chemokine 10 (CXCL10) Active Protein | CXCL10 active protein

Recombinant Human C-X-C Motif Chemokine 10 (CXCL10)

Cat. Num. AAA7114947

• Gene Names: CXCL10; C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-X-C Motif Chemokine 10 (CXCL10); Recombinant Human C-X-C Motif Chemokine 10 (CXCL10); C-X-C Motif Chemokine 10; 10 kDa Interferon Gamma-Induced Protein; Gamma-IP10; IP-10; Small-Inducible Cytokine B10; CXCL10; INP10; SCYB10; CXCL10 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.0
• Sequence Positions: 22-98aa; Full Length of Mature Protein
• Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
• Sequence Length: 98

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to chemoattract human CXCR3 transfected BaF3 mouse proB cells is typically 0.02-0.06 mug/mL.
• Subcellular Location: Secreted
• Protein Families: Intercrine alpha (chemokine CxC) Family
• Classification: Cytokine
• Subdivision: Chemokine
• Pathway: Chemokine Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for CXCL10 active protein

Relevance: Human C-X-C Motif Chemokine Ligand 10 (CXCL10) is a non-ELR chemokine secreted by various cell types, such as monocytes, endothelial cells and fibroblasts, in response to IFN-gamma. CXCL10 functions via chemokine receptor CXCR3. CXCL10 has been attributed to several roles, such as chemoattraction for activated T-lymphocytes, inhibition of angiogenesis, and antitumor activity.

Function: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Product Categories/Family for CXCL10 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 149999382
• NCBI GeneID: 3627
• NCBI Accession #: NP_001556.2
• NCBI GenBank Nucleotide #: NM_001565.4
• UniProt Accession #: P02778
• Molecular Weight: 8.6 kDa
• NCBI Official Full Name: C-X-C motif chemokine 10
• NCBI Official Synonym Full Names: C-X-C motif chemokine ligand 10
• NCBI Official Symbol: CXCL10
• NCBI Official Synonym Symbols: C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• NCBI Protein Information: C-X-C motif chemokine 10
• UniProt Protein Name: C-X-C motif chemokine 10
• Protein Family: C-X-C motif chemokine
• UniProt Gene Name: CXCL10
• UniProt Synonym Gene Names: INP10; SCYB10; Gamma-IP10; IP-10
• UniProt Entry Name: CXL10_HUMAN

NCBI Description

This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq, Sep 2014]

Uniprot Description

CXCL10: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Chemokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space; extracellular region; external side of plasma membrane

Molecular Function: heparin binding; protein binding; CXCR3 chemokine receptor binding; chemokine activity; cAMP-dependent protein kinase regulator activity; receptor binding

Biological Process: muscle development; blood circulation; protein secretion; positive regulation of leukocyte chemotaxis; positive regulation of cAMP metabolic process; chemotaxis; signal transduction; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; cell surface receptor linked signal transduction; response to vitamin D; cell-cell signaling; positive regulation of cell proliferation; response to gamma radiation; positive regulation of transcription from RNA polymerase II promoter; immune response; positive regulation of release of sequestered calcium ion into cytosol; response to cold; inflammatory response; negative regulation of myoblast differentiation; regulation of protein kinase activity; defense response to virus