Western Blot (WB)
(Host: RabbitTarget Name: GFI1BSample Tissue: Mouse Spleen lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse GFI1B Polyclonal Antibody | anti-GFI1B antibody
GFI1B Antibody-C-terminal region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GFI1B; Polyclonal Antibody; GFI1B Antibody-C-terminal region; zinc finger protein Gfi-1b; Gfi-1B; anti-GFI1B antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
QVCGKAFSQSSNLITHSRKHTGFKPFSCELCTKGFQRKVDLRRHRESQHN
Applicable Applications for anti-GFI1B antibody
Western Blot (WB)
Protein Size
330 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse GFI1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: GFI1BSample Tissue: Mouse Spleen lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GFI1BSample Tissue: Mouse Spleen lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GFI1B antibody
Description of Target: Essential proto-oncogenic transcriptional regulator necessary for development and differentiation of erythroid and megakaryocytic lineages. Component of a RCOR-GFI-KDM1A-HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development and controls hematopoietic differentiation. Transcriptional repressor or activator depending on both promoter and cell type context; represses promoter activity of SOCS1 and SOCS3 and thus, may regulate cytokine signaling pathways. Cooperates with GATA1 to repress target gene transcription, such as the apoptosis regulator BCL2L1; GFI1B silencing in leukemic cell lines markedly increase apoptosis rate. Inhibits down-regulation of MYC and MYB as well as the cyclin-dependent kinase inhibitor CDKN1A/P21WAF1 in IL6-treated myelomonocytic cells. Represses expression of GATA3 in T-cell lymphomas and inhibits GATA1-mediated transcription; as GATA1 also mediates erythroid GFI1B transcription, both GATA1 and GFI1B participate in a feedback regulatory pathway controlling the expression of GFI1B gene in erythroid cells. Suppresses GATA1-mediated stimulation of GFI1B promoter through protein interaction. Binds to gamma-satellite DNA and to its own promoter, auto-repressing its own expression. Alters histone methylation by recruiting histone methyltransferase to target genes promoters. Plays a role in heterochromatin formation.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
36kDa
UniProt Protein Name
Zinc finger protein Gfi-1b
Protein Family
UniProt Gene Name
Gfi1b
UniProt Entry Name
GFI1B_MOUSE
Similar Products
Product Notes
The GFI1B gfi1b (Catalog #AAA3249795) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GFI1B Antibody-C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GFI1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GFI1B gfi1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QVCGKAFSQS SNLITHSRKH TGFKPFSCEL CTKGFQRKVD LRRHRESQHN. It is sometimes possible for the material contained within the vial of "GFI1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
