Dual specificity tyrosine-phosphorylation-regulated kinase 3 (DYRK3) Recombinant Protein | DYRK3 recombinant protein

Recombinant Human Dual specificity tyrosine-phosphorylation-regulated kinase 3 (DYRK3)

Cat. Num. AAA1181208

• Gene Names: DYRK3; RED; REDK; DYRK5; hYAK3-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Dual specificity tyrosine-phosphorylation-regulated kinase 3 (DYRK3); Recombinant Human Dual specificity tyrosine-phosphorylation-regulated kinase 3 (DYRK3); DYRK3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-588, Full length protein
• Sequence: MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS
• Sequence Length: 588

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for DYRK3 recombinant protein

This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine
threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

• NCBI GI #: 51702242
• NCBI GeneID: 8444
• NCBI Accession #: NP_001004023.1
• NCBI GenBank Nucleotide #: NM_001004023.1
• UniProt Accession #: O43781; Q7Z752; Q9HBY6; Q9HBY7; D3DT79
• Molecular Weight: 63,977 Da
• NCBI Official Full Name: dual specificity tyrosine-phosphorylation-regulated kinase 3 isoform b
• NCBI Official Synonym Full Names: dual specificity tyrosine phosphorylation regulated kinase 3
• NCBI Official Symbol: DYRK3
• NCBI Official Synonym Symbols: RED; REDK; DYRK5; hYAK3-2
• NCBI Protein Information: dual specificity tyrosine-phosphorylation-regulated kinase 3
• UniProt Protein Name: Dual specificity tyrosine-phosphorylation-regulated kinase 3
• Protein Family: Dual specificity tyrosine-phosphorylation-regulated kinase
• UniProt Gene Name: DYRK3
• UniProt Synonym Gene Names: REDK

NCBI Description

This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

Dual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities. Negative regulator of EPO-dependent erythropoiesis, may place an upper limit on red cell production during stress erythropoiesis. Inhibits cell death due to cytokine withdrawal in hematopoietic progenitor cells (PubMed:10779429). May act by regulating CREB/CRE signaling (). Stabilizes and prevents stress granule disassembly thereby regulating mTORC1 signaling during cellular stress. During stressful conditions, DYRK3 partitions to the stress granule from the cytosol, as well as mTORC1 components, which prevents mTORC1 signaling. When stress signals are gone, the kinase activity of DYRK3 is required for the dissolution of stress granule and mTORC1 relocation to the cytosol, and promotes the phosphorylation of the mTORC1 inhibitor, AKT1S1, allowing full reactivation of mTORC1 signaling (PubMed:23415227). Promotes cell survival upon genotoxic stress through phosphorylation of SIRT1. This in turn inhibits TP53 activity and apoptosis (PubMed:20167603).