Dynein light chain 1, cytoplasmic (DYNLL1) Recombinant Protein | DYNLL1 recombinant protein

Recombinant Human Dynein light chain 1, cytoplasmic (DYNLL1)

Cat. Num. AAA951368

• Gene Names: DYNLL1; LC8; PIN; DLC1; DLC8; LC8a; DNCL1; hdlc1; DNCLC1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Dynein light chain 1; cytoplasmic (DYNLL1); Recombinant Human Dynein light chain 1; DYNLL1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-89, Full length protein
• Sequence: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
• Sequence Length: 89

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for DYNLL1 recombinant protein

Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized.

NCBI and Uniprot Product Information

• NCBI GI #: 83267866
• NCBI GeneID: 8655
• NCBI Accession #: NP_001032583.1
• NCBI GenBank Nucleotide #: NM_001037494.1
• UniProt Accession #: P63167; Q15701
• Molecular Weight: 10,366 Da
• NCBI Official Full Name: dynein light chain 1, cytoplasmic
• NCBI Official Synonym Full Names: dynein light chain LC8-type 1
• NCBI Official Symbol: DYNLL1
• NCBI Official Synonym Symbols: LC8; PIN; DLC1; DLC8; LC8a; DNCL1; hdlc1; DNCLC1
• NCBI Protein Information: dynein light chain 1, cytoplasmic
• UniProt Protein Name: Dynein light chain 1, cytoplasmic
• UniProt Gene Name: DYNLL1
• UniProt Synonym Gene Names: DLC1; DNCL1; DNCLC1; HDLC1; DLC8; PIN

NCBI Description

Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.