SDS-Page
Dermatopontin Recombinant Protein | DPT recombinant protein
Human CellExp Dermatopontin, Human Recombinant
Gene Names
DPT; TRAMP
Purity
>95% by SDS-PAGE
Synonyms
Dermatopontin; Human CellExp Dermatopontin; Human Recombinant; Tyrosine-rich acidic matrix protein; TRAMP and DPT; DPT recombinant protein
Host
HEK293 cells
Purity/Purification
>95% by SDS-PAGE
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4
Sequence
QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Gene Source
Human
Reconstitution Instruction
Reconstitute in sterile deionized water to a concentration of 100 ug/ml.
Preparation and Storage
Store at -20 degree C
Centrifuge the vial prior to opening.
Shelf life: ~12 months
Centrifuge the vial prior to opening.
Shelf life: ~12 months
SDS-Page
SDS-Page
Related Product Information for DPT recombinant protein
Dermatopontin, also known as Tyrosine-rich acidic matrix protein, TRAMP and DPT, is a secreted protein which belongs to the dermatopontin family. DPT is expressed in various tissues, such as fibroblasts, heart, skeletal muscle, brain and pancreas. It seems to mediate adhesion by cell surface integrin binding. DPT may serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. DPT can enhance TGFB1 activity through interaction with decorin. In addition, DPT accelerates collagen fibril formation, stabilizes collagen fibrils against low-temperature dissociation and inhibits cell proliferation. Tyrosine-rich acidic matrix protein that communicate between the dermal fibroblast cell surface and its extracellular matrix environment
Product Categories/Family for DPT recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,005 Da
NCBI Official Full Name
dermatopontin
NCBI Official Synonym Full Names
dermatopontin
NCBI Official Symbol
DPT
NCBI Official Synonym Symbols
TRAMP
NCBI Protein Information
dermatopontin
UniProt Protein Name
Dermatopontin
Protein Family
UniProt Gene Name
DPT
UniProt Synonym Gene Names
TRAMP
NCBI Description
Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq, Jul 2008]
Uniprot Description
Seems to mediate adhesion by cell surface integrin binding. May serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. Enhances TGFB1 activity. Inhibits cell proliferation. Accelerates collagen fibril formation, and stabilizes collagen fibrils against low-temperature dissociation ().
Research Articles on DPT
Similar Products
Product Notes
The DPT dpt (Catalog #AAA849943) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QYGDYGYPYQ QYHDYSDDGW VNLNRQGFSY QCPQGQVIVA VRSIFSKKEG SDRQWNYACM PTPQSLGEPT ECWWEEINRA GMEWYQTCSN NGLVAGFQSR YFESVLDREW QFYCCRYSKR CPYSCWLTIE YPGHYGEEMD MISYNYDYYI RGATTTFSAV ERDRQWKFIM CRMTEYDCEF ANVVDDIEGR MDEPKSCDKT HTCPPCPAPE LLGGPSVFLF PPKPKDTLMI SRTPEVTCVV VDVSHEDPEV KFNWYVDGVE VHNAKTKPRE EQYNSTYRVV SVLTVLHQDW LNGKEYKCKV SNKALPAPIE KTISKAKGQP REPQVYTLPP SREEMTKNQV SLTCLVKGFY PSDIAVEWES NGQPENNYKT TPPVLDSDGS FFLYSKLTVD KSRWQQGNVF SCSVMHEALH NHYTQKSLSL SPGKHHHHHH. It is sometimes possible for the material contained within the vial of "Dermatopontin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
