Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase (DHDH) Recombinant Protein | DHDH recombinant protein

Recombinant Bovine Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase (DHDH)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Trans-1; 2-dihydrobenzene-1; 2-diol dehydrogenase (DHDH); Recombinant Bovine Trans-1; DHDH recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-335, full length protein
Sequence
MALRWGIVSAGLISSDFTTMLRMLPRSEHQVVAVAARDLSRAKEFAKKHDIPKAYGSYEELAKDPDVEVAYIGTQHPQHKAAVLLCLTAGKAVLCEKPMGVNAAEVREMVAEARSRGLFFMEAIWTRFFPAVEALRSVLAQGTLGDLRVVRAEFGKNLTHVHRATDWAQAGGGLLDLGIYCLQFISMVFGGQKPEKISAVGRRHETGVDDTVTVILQYPGGVHGSFTCSISAQLSNTVSVSGTKGMAQLLDPCWSPTELVVKGEHKEFPLPPAPGKEFNFTNGMGMSYEAKHVRECLQKGLKESPVIPLVESELLADILEEVRKAIGITFPQDKH
Sequence Length
335
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for DHDH recombinant protein
This gene encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,583 Da
NCBI Official Full Name
trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
NCBI Official Synonym Full Names
dihydrodiol dehydrogenase
NCBI Official Symbol
DHDH
NCBI Protein Information
trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
UniProt Protein Name
Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
UniProt Gene Name
DHDH

Similar Products

Product Notes

The DHDH dhdh (Catalog #AAA1434185) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-335, full length protein. The amino acid sequence is listed below: MALRWGIVSA GLISSDFTTM LRMLPRSEHQ VVAVAARDLS RAKEFAKKHD IPKAYGSYEE LAKDPDVEVA YIGTQHPQHK AAVLLCLTAG KAVLCEKPMG VNAAEVREMV AEARSRGLFF MEAIWTRFFP AVEALRSVLA QGTLGDLRVV RAEFGKNLTH VHRATDWAQA GGGLLDLGIY CLQFISMVFG GQKPEKISAV GRRHETGVDD TVTVILQYPG GVHGSFTCSI SAQLSNTVSV SGTKGMAQLL DPCWSPTELV VKGEHKEFPL PPAPGKEFNF TNGMGMSYEA KHVRECLQKG LKESPVIPLV ESELLADILE EVRKAIGITF PQDKH. It is sometimes possible for the material contained within the vial of "Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase (DHDH), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.