Macrophage colony-stimulating factor 1 (CSF1) Recombinant Protein | CSF1 recombinant protein

Recombinant Human Macrophage colony-stimulating factor 1 (CSF1), partial

Cat. Num. AAA7135747

• Gene Names: CSF1; MCSF; CSF-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Macrophage colony-stimulating factor 1 (CSF1); Recombinant Human Macrophage colony-stimulating factor 1 (CSF1); partial; Lanimostim (CSF-1); (M-CSF); (MCSF); CSF1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid or Lyophilized powder; If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, p
• Sequence Positions: 33-190aa; Partial
• Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN
• Sequence Length: 554

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Expression System: Yeast
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. ; Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.; The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for CSF1 recombinant protein

Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance

Product Categories/Family for CSF1 recombinant protein

Cardiovascular

References

"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 181135
• NCBI GeneID: 1435
• UniProt Accession #: P09603
• Molecular Weight: 19.9kDa
• NCBI Official Full Name: colony-stimulating factor (CSF-1)
• NCBI Official Synonym Full Names: colony stimulating factor 1
• NCBI Official Symbol: CSF1
• NCBI Official Synonym Symbols: MCSF; CSF-1
• NCBI Protein Information: macrophage colony-stimulating factor 1
• UniProt Protein Name: Macrophage colony-stimulating factor 1
• Protein Family: Macrophage colony-stimulating factor
• UniProt Gene Name: CSF1
• UniProt Synonym Gene Names: CSF-1; M-CSF; MCSF
• UniProt Entry Name: CSF1_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]

Uniprot Description

M-CSF: Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance. Aberrant expression of CSF1 or CSF1R can promote cancer cell proliferation, invasion and formation of metastases. Overexpression of CSF1 or CSF1R is observed in a significant percentage of breast, ovarian, prostate, and endometrial cancers. Aberrant expression of CSF1 or CSF1R may play a role in inflammatory diseases, such as rheumatoid arthritis, glomerulonephritis, atherosclerosis, and allograft rejection. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cytokine

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: extracellular space; membrane; perinuclear region of cytoplasm; plasma membrane; integral to membrane; receptor complex

Molecular Function: protein homodimerization activity; growth factor activity; cytokine activity; macrophage colony stimulating factor receptor binding

Biological Process: positive regulation of monocyte differentiation; ossification; macrophage differentiation; positive regulation of osteoclast differentiation; positive regulation of cellular protein metabolic process; reproductive developmental process; positive regulation of odontogenesis of dentine-containing teeth; osteoclast differentiation; positive regulation of multicellular organism growth; odontogenesis; cell proliferation; positive regulation of mononuclear cell proliferation; monocyte activation; homeostasis of number of cells within a tissue; positive regulation of protein kinase activity; positive regulation of cell proliferation; innate immune response; hemopoiesis; positive regulation of Ras protein signal transduction; positive regulation of macrophage differentiation; cell differentiation; positive regulation of cell-matrix adhesion; inflammatory response; regulation of ossification; positive regulation of cell migration