Rabbit anti-Human SKA2 Polyclonal Antibody | anti-SKA2 antibody

Anti-SKA2 Antibody

Cat. Num. AAA1753134

• Gene Names: SKA2; FAM33A
• Reactivity: Human
• Applications: Western Blot, Flow Cytometry, Functional Assay
• Purity: Immunogen affinity purified.
• Synonyms: SKA2; Polyclonal Antibody; Anti-SKA2 Antibody; Spindle and kinetochore-associated protein 2; Protein FAM33A; FAM33A; anti-SKA2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: No cross reactivity with other proteins.
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 121

• Applicable Applications for anti-SKA2 antibody: Western Blot (WB), Flow Cytometry (FC/FACS)
• Application Notes: WB: 0.25-0.5ug/ml (Human); FC/FACS: 1-3ug/1x106 cells (Human); Tested Species: In-house tested species with positive results.
• Immunogen: A synthetic peptide corresponding to a sequence of human SKA2 (EAEVDKLELMFQKAESDLDYIQYRLEYEIK).
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen store at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Flow Cytometry (FC/FACS)

Flow Cytometry (FC/FACS)

Western Blot (WB)

Related Product Information for anti-SKA2 antibody

Description: Rabbit IgG polyclonal antibody for SKA2 detection. Tested with WB, FCM in Human.

Background: Spindle and kinetochore-associated protein 2 is a protein that in humans is encoded by the SKA2 gene found in chromosome 17.SKA2 is a part of a spindle and kinetochore associated complex also including SKA1 and SKA3 which is responsible for onset of the anaphase in mitosis by regulating chromosomal segregation. SKA2 may function as a prognostic gene marker for identifying lung cancer[3] as well as a proposed biomarker for suicidal tendencies and post-traumatic stress disorders.[4][5] The SKA2 gene contains one single-nucleotide polymorphism (SNP) rs7208505 located in the 3' UTR. This genetic variant containing a cytosine (existing in the less common allele) instead of thymine along with epigenetic modification (such as DNA methylation) is correlated with suicidal tendencies and post-traumatic stress

References

1. Hanisch A, Silljé HH, Nigg EA (November 2006). "Timely anaphase onset requires a novel spindle and kinetochore complex comprising Ska1 and Ska2". The EMBO Journal. 25 (23): 5504-15.
2. Wang Y, Zhang Y, Zhang C, Weng H, Li Y, Cai W, Xie M, Long Y, Ai Q, Liu Z, Du G, Wang S, Niu Y, Song F, Ozaki T, Bu Y (September 2015). "The gene pair PRR11 and SKA2 shares a NF-Y-regulated bidirectional promoter and contributes to lung cancer development". Biochimica et Biophysica Acta. 1849 (9): 1133-44.
3. Guintivano J, Brown T, Newcomer A, Jones M, Cox O, Maher BS, Eaton WW, Payne JL, Wilcox HC, Kaminsky ZA (December 2014). "Identification and replication of a combined epigenetic and genetic biomarker predicting suicide and suicidal behaviors". The American Journal of Psychiatry. 171 (12): 1287-96.

NCBI and Uniprot Product Information

• NCBI GI #: 32699054
• NCBI GeneID: 348235
• NCBI Accession #: NP_872426
• NCBI GenBank Nucleotide #: NP_872426.1
• UniProt Accession #: Q8WVK7
• NCBI Official Full Name: spindle and kinetochore-associated protein 2 isoform 1
• NCBI Official Synonym Full Names: spindle and kinetochore associated complex subunit 2
• NCBI Official Symbol: SKA2
• NCBI Official Synonym Symbols: FAM33A
• NCBI Protein Information: spindle and kinetochore-associated protein 2
• UniProt Protein Name: Spindle and kinetochore-associated protein 2
• Protein Family: Spindle and kinetochore-associated protein
• UniProt Gene Name: SKA2
• UniProt Synonym Gene Names: FAM33A
• UniProt Entry Name: SKA2_HUMAN

Uniprot Description

SKA2: Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. In the complex, it is required for SKA1 localization. Belongs to the SKA2 family.

Chromosomal Location of Human Ortholog: 17q22

Cellular Component: spindle microtubule; outer kinetochore of condensed chromosome; cytosol

Molecular Function: protein binding; microtubule binding

Biological Process: mitosis; cell division; mitotic cell cycle; regulation of microtubule polymerization or depolymerization; chromosome segregation