Macrophage colony-stimulating factor 1 Recombinant Protein | Csf1 recombinant protein

Recombinant Mouse Macrophage colony-stimulating factor 1

Cat. Num. AAA1265135

• Gene Names: Csf1; op; Csfm; MCSF; C87615
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Macrophage colony-stimulating factor 1; Recombinant Mouse Macrophage colony-stimulating factor 1; Csf1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 33-262aa; Partial
• Sequence: KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
• Sequence Length: 257

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Csf1 recombinant protein

Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hatopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and fale fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.

References

Nucleotide sequence of a cDNA encoding murine CSF-1 (Macrophage-CSF) .Delamarter J.F., Hession C., Semon D., Gough N.M., Rothenbuhler R., Mermod J.-J.Nucleic Acids Res. 15:2389-2390(1987) cDNA cloning and expression of murine macrophage colony-stimulating factor from L929 cells.Ladner M.B., Martin G.A., Noble J.A., Wittman V.P., Warren M.K., McGrogan M., Stanley E.R.Proc. Natl. Acad. Sci. U.S.A. 85:6706-6710(1988) Isolation and characterization of a cDNA clone encoding for rat CSF-1 gene. Post-transcriptional repression occurs in myogenic differentiation.Borycki A.G., Lenormund J., Guillier M., Leibovitch S.A.Biochim. Biophys. Acta 1174:143-152(1993) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Cloning and tissue-specific expression of mouse macrophage colony-stimulating factor mRNA.Rajavashisth T.B., Eng R., Shadduck R.K., Waheed A., Ben-Avram C.M., Shively J.E., Lusis A.J.Proc. Natl. Acad. Sci. U.S.A. 84:1157-1161(1987) Amino-terminal amino acid sequence of murine colony-stimulating factor 1.Ben-Avram C.M., Shively J.E., Shadduck R.K., Waheed A., Rajavashisth T.B., Lusis A.J.Proc. Natl. Acad. Sci. U.S.A. 82:4486-4489(1985) Cloning and characterization of the murine promoter for the colony-stimulating factor-1-encoding gene.Harrington M.A., Edenberg H.J., Saxman S.M., Pedigo L.M., Daub R., Broxmeyer H.E.Gene 102:165-170(1991) Mutation of macrophage colony stimulating factor (Csf1) causes osteopetrosis in the tl rat.Dobbins D.E., Sood R., Hashiramoto A., Hansen C.T., Wilder R.L., Remmers E.F.Biochem. Biophys. Res. Commun. 294:1114-1120(2002) The osteopetrotic mutation toothless (tl) is a loss-of-function frameshift mutation in the rat Csf1 gene evidence of a crucial role for CSF-1 in osteoclastogenesis and endochondral ossification.Van Wesenbeeck L., Odgren P.R., MacKay C.A., D'Angelo M., Safadi F.F., Popoff S.N., Van Hul W., Marks S.C. Jr.Proc. Natl. Acad. Sci. U.S.A. 99:14303-14308(2002) The predominant form of secreted colony stimulating factor-1 is a proteoglycan.Price L.K.H., Choi H.U., Rosenberg L., Stanley E.R.J. Biol. Chem. 267:2190-2199(1992) The murine mutation osteopetrosis is in the coding region of the macrophage colony stimulating factor gene.Yoshida H., Hayashi S., Kunisada T., Ogawa M., Nishikawa S., Okamura H., Sudo T., Shultz L.D., Nishikawa S.Nature 345:442-444(1990) Structure of macrophage colony stimulating factor bound to FMS diverse signaling assemblies of class III receptor tyrosine kinases.Chen X., Liu H., Focia P.J., Shim A.H., He X.Proc. Natl. Acad. Sci. U.S.A. 105:18267-18272(2008)

NCBI and Uniprot Product Information

• NCBI GI #: 166064046
• NCBI GeneID: 12977
• NCBI Accession #: NP_001107001.1
• NCBI GenBank Nucleotide #: NM_001113529.1
• UniProt Accession #: P07141; Q3U395; Q8R3C8
• Molecular Weight: 30 kDa
• NCBI Official Full Name: macrophage colony-stimulating factor 1 isoform 2
• NCBI Official Synonym Full Names: colony stimulating factor 1 (macrophage)
• NCBI Official Symbol: Csf1
• NCBI Official Synonym Symbols: op; Csfm; MCSF; C87615
• NCBI Protein Information: macrophage colony-stimulating factor 1
• UniProt Protein Name: Macrophage colony-stimulating factor 1
• Protein Family: Macrophage colony-stimulating factor
• UniProt Gene Name: Csf1
• UniProt Synonym Gene Names: Csfm; CSF-1; MCSF
• UniProt Entry Name: CSF1_MOUSE

Uniprot Description

M-CSF: Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance. Aberrant expression of CSF1 or CSF1R can promote cancer cell proliferation, invasion and formation of metastases. Overexpression of CSF1 or CSF1R is observed in a significant percentage of breast, ovarian, prostate, and endometrial cancers. Aberrant expression of CSF1 or CSF1R may play a role in inflammatory diseases, such as rheumatoid arthritis, glomerulonephritis, atherosclerosis, and allograft rejection. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cytokine

Cellular Component: extracellular region; extracellular space; integral to membrane; membrane; perinuclear region of cytoplasm; plasma membrane

Molecular Function: cytokine activity; growth factor activity; macrophage colony stimulating factor receptor binding; protein binding; protein homodimerization activity

Biological Process: cell proliferation; homeostasis of number of cells within a tissue; immune system process; inflammatory response; innate immune response; macrophage differentiation; odontogenesis; ossification; osteoclast differentiation; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of cell-matrix adhesion; positive regulation of cellular protein metabolic process; positive regulation of macrophage differentiation; positive regulation of monocyte differentiation; positive regulation of mononuclear cell proliferation; positive regulation of multicellular organism growth; positive regulation of odontogenesis of dentine-containing teeth; positive regulation of osteoclast differentiation; positive regulation of protein kinase activity; positive regulation of Ras protein signal transduction; regulation of ossification; reproductive developmental process; transmembrane receptor protein tyrosine kinase signaling pathway