Death domain-containing protein CRADD (Cradd) Recombinant Protein | Cradd recombinant protein
Recombinant Mouse Death domain-containing protein CRADD (Cradd)
Gene Names
Cradd; RAIDD
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Death domain-containing protein CRADD (Cradd); Recombinant Mouse Death domain-containing protein CRADD (Cradd); Cradd recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-199, Full length protein
Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEIKAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLEKAREEVTAELPTGDWMAGIPSHILSSSPSDQQINQLAQRLGPEWEPVVLSLGLSQTDIYRCKANHPHNVHSQVVEAFVRWRQRFGKQATFLSLHKGLQAVEADPSLLQHMLE
Sequence Length
199
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cradd recombinant protein
This protein is a death domain (CARD
DD)-containing protein and has been shown to induce cell apoptosis. Through its CARD domain, this protein interacts with, and thus recruits, caspase 2
ICH1 to the cell death signal transduction complex that includes tumor necrosis factor receptor 1 (TNFR1A), RIPK1
RIP kinase, and numbers of other CARD domain-containing proteins.
DD)-containing protein and has been shown to induce cell apoptosis. Through its CARD domain, this protein interacts with, and thus recruits, caspase 2
ICH1 to the cell death signal transduction complex that includes tumor necrosis factor receptor 1 (TNFR1A), RIPK1
RIP kinase, and numbers of other CARD domain-containing proteins.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,656 Da
NCBI Official Full Name
death domain-containing protein CRADD
NCBI Official Synonym Full Names
CASP2 and RIPK1 domain containing adaptor with death domain
NCBI Official Symbol
Cradd
NCBI Official Synonym Symbols
RAIDD
NCBI Protein Information
death domain-containing protein CRADD
UniProt Protein Name
Death domain-containing protein CRADD
Protein Family
UniProt Gene Name
Cradd
UniProt Synonym Gene Names
Raidd
Uniprot Description
Apoptotic adaptor molecule specific for caspase-2 and FASL/TNF receptor-interacting protein RIP. In the presence of RIP and TRADD, CRADD recruits caspase-2 to the TNFR-1 signalling complex ().
Research Articles on Cradd
Similar Products
Product Notes
The Cradd cradd (Catalog #AAA1028923) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-199, Full length protein. The amino acid sequence is listed below: MEARDKQVLR SLRLELGAEV LVEGLVLQYL YQEGILTENH IQEIKAQTTG LRKTMLLLDI LPSRGPKAFD TFLDSLQEFP WVREKLEKAR EEVTAELPTG DWMAGIPSHI LSSSPSDQQI NQLAQRLGPE WEPVVLSLGL SQTDIYRCKA NHPHNVHSQV VEAFVRWRQR FGKQATFLSL HKGLQAVEAD PSLLQHMLE. It is sometimes possible for the material contained within the vial of "Death domain-containing protein CRADD (Cradd), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
