Carboxypeptidase A2 (Cpa2) Recombinant Protein | Cpa2 recombinant protein
Recombinant Mouse Carboxypeptidase A2 (Cpa2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carboxypeptidase A2 (Cpa2); Recombinant Mouse Carboxypeptidase A2 (Cpa2); Cpa2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
113-417, full length protein
Sequence
GTNFNFGAYHTLEEIYQEMDNLVAENPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIASDYGTDPAITSLLNTLDVFLLPVTNPDGYVFSQTSNRMWRKTRSKRSGSFCVGVDPNRNWDANFGGPGASSNPCSDSYHGPSPNSEVEVKSIVDFIKSHGKVKAFITLHSYSQLLMFPYGYKCAKPDDFNELDEVAQRAAQSLKRLHGTSYKVGPICSVIYQASGGSIDWAYDLGIKYSFAFELRDTGYYGFLLPAKQILPTAEETWLGLKTIMEHVRDHPY
Sequence Length
305
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cpa2 recombinant protein
Three different forms of human pancreatic procarboxypeptidase A have been isolated. The encoded protein represents the A2 form, which is a monomeric protein with different biochemical properties from the A1 and A3 forms. The A2 form of pancreatic procarboxypeptidase acts on aromatic C-terminal residues and is a secreted protein.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,057 Da
NCBI Official Full Name
carboxypeptidase A2 preproprotein
NCBI Official Synonym Full Names
carboxypeptidase A2, pancreatic
NCBI Official Symbol
Cpa2
NCBI Protein Information
carboxypeptidase A2
UniProt Protein Name
Carboxypeptidase A2
Protein Family
UniProt Gene Name
Cpa2
NCBI Description
This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. The encoded preproprotein undergoes proteolytic processing that removes the N-terminal activation peptide to generate a functional enzyme. This gene is expressed by the pancreatic exocrine cells which secrete the enzyme during digestion. This gene is located in a cluster of carboxypeptidase genes on chromosome 6. [provided by RefSeq, Jul 2016]
Similar Products
Product Notes
The Cpa2 cpa2 (Catalog #AAA1452407) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 113-417, full length protein. The amino acid sequence is listed below: GTNFNFGAYH TLEEIYQEMD NLVAENPGLV SKVNIGSSFE NRPMNVLKFS TGGDKPAIWL DAGIHAREWV TQATALWTAN KIASDYGTDP AITSLLNTLD VFLLPVTNPD GYVFSQTSNR MWRKTRSKRS GSFCVGVDPN RNWDANFGGP GASSNPCSDS YHGPSPNSEV EVKSIVDFIK SHGKVKAFIT LHSYSQLLMF PYGYKCAKPD DFNELDEVAQ RAAQSLKRLH GTSYKVGPIC SVIYQASGGS IDWAYDLGIK YSFAFELRDT GYYGFLLPAK QILPTAEETW LGLKTIMEHV RDHPY. It is sometimes possible for the material contained within the vial of "Carboxypeptidase A2 (Cpa2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
