Western Blot (WB)
(Host: RabbitTarget Name: UBR3Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit UBR3 Polyclonal Antibody | anti-UBR3 antibody
UBR3 Antibody - C-terminal region
Gene Names
UBR3; ZNF650
Reactivity
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat; Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
UBR3; Polyclonal Antibody; UBR3 Antibody - C-terminal region; anti-UBR3 antibody
Host
Rabbit
Reactivity
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat; Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGKP
Sequence Length
43
Applicable Applications for anti-UBR3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human UBR3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: UBR3Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: UBR3Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-UBR3 antibody
ubiquitin protein ligase E3 component n-recognin 3 (putative)
Target Description: E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Does not bind to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
Target Description: E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Does not bind to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
Product Categories/Family for anti-UBR3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
394
NCBI Official Full Name
E3 ubiquitin-protein ligase UBR3
NCBI Official Synonym Full Names
ubiquitin protein ligase E3 component n-recognin 3
NCBI Official Symbol
UBR3
NCBI Official Synonym Symbols
ZNF650
NCBI Protein Information
E3 ubiquitin-protein ligase UBR3
UniProt Protein Name
E3 ubiquitin-protein ligase UBR3
Protein Family
UniProt Gene Name
UBR3
UniProt Synonym Gene Names
KIAA2024; ZNF650
UniProt Entry Name
UBR3_HUMAN
Research Articles on UBR3
1. UBR3/6 regulate cardiomyocyte Nav 1.5 channel protein levels via the ubiquitin-proteasome pathway.
Similar Products
Product Notes
The UBR3 ubr3 (Catalog #AAA3206876) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBR3 Antibody - C-terminal region reacts with Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat; Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's UBR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBR3 ubr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQNCGAGTGI FLLINASVII IIRGHRFCLW GSVYLDAHGE EDRDLRRGKP. It is sometimes possible for the material contained within the vial of "UBR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
