Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CCBL1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human KYAT1 Polyclonal Antibody | anti-KYAT1 antibody

KYAT1 Antibody - middle region

Gene Names
KYAT1; GTK; KAT1; KATI; CCBL1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KYAT1; Polyclonal Antibody; KYAT1 Antibody - middle region; anti-KYAT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQ
Sequence Length
372
Applicable Applications for anti-KYAT1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CCBL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CCBL1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CCBL1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KYAT1 antibody
This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene.
Product Categories/Family for anti-KYAT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
883
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
kynurenine--oxoglutarate transaminase 1 isoform a
NCBI Official Synonym Full Names
kynurenine aminotransferase 1
NCBI Official Symbol
KYAT1
NCBI Official Synonym Symbols
GTK; KAT1; KATI; CCBL1
NCBI Protein Information
kynurenine--oxoglutarate transaminase 1
UniProt Protein Name
Kynurenine--oxoglutarate transaminase 1
UniProt Gene Name
CCBL1
UniProt Synonym Gene Names
GTK; KATI
UniProt Entry Name
KAT1_HUMAN

NCBI Description

This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CCBL1: Catalyzes the irreversible transamination of the L- tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Metabolizes the cysteine conjugates of certain halogenated alkenes and alkanes to form reactive metabolites. Catalyzes the beta- elimination of S-conjugates and Se-conjugates of L- (seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond. Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.6.1.64; EC 2.6.1.7; EC 4.4.1.13; Lyase; Transferase

Chromosomal Location of Human Ortholog: 9q34.11

Cellular Component: cytoplasm; cytosol; nucleoplasm

Molecular Function: glutamine-pyruvate transaminase activity; kynurenine-oxoglutarate transaminase activity; phenylalanine(histidine) transaminase activity; protein binding; protein homodimerization activity; transaminase activity

Biological Process: amino acid biosynthetic process; amino acid derivative metabolic process; L-phenylalanine catabolic process; tryptophan catabolic process

Research Articles on KYAT1

Similar Products

Product Notes

The KYAT1 ccbl1 (Catalog #AAA3222847) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KYAT1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KYAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KYAT1 ccbl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGKFTSRTKA LVLNTPNNPL GKVFSREELE LVASLCQQHD VVCITDEVYQ. It is sometimes possible for the material contained within the vial of "KYAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.