Coronin-1A (Coro1a) Recombinant Protein | Coro1a recombinant protein
Recombinant Rat Coronin-1A (Coro1a)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Coronin-1A (Coro1a); Recombinant Rat Coronin-1A (Coro1a); Coro1a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-461, full length protein
Sequence
SRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFMALICEASGGGAFLVLPLGKTGRVDKNVPLVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLVLPLREPVVTLEGHTKRVGIVAWHPTAQNVLLSAGCDNVILVWDVGTGAAVLTLGPDVHPDTIYSVDWSRDGALICTSCRDKRVRVIEPRKGTVVAEKERPHEGTRPVHAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERKCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLSGRDAGPLLISLKDGYVPPKSRELRVNRGLDSARRRATPEPSSTLSSDTVSRLEEDVRNLNAIVQKLQERLDRLEETVQAK
Sequence Length
460
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,065 Da
NCBI Official Full Name
coronin-1A
NCBI Official Synonym Full Names
coronin 1A
NCBI Official Symbol
Coro1a
NCBI Protein Information
coronin-1A
UniProt Protein Name
Coronin-1A
Protein Family
UniProt Gene Name
Coro1a
UniProt Synonym Gene Names
Coro1; Clipin-A; TACO
NCBI Description
actin binding protein; human homolog may be a component of the cytoskeleton and may be involved in mitosis [RGD, Feb 2006]
Uniprot Description
May be a crucial component of the cytoskeleton of highly motile cells, functioning both in the invagination of large pieces of plasma membrane, as well as in forming protrusions of the plasma membrane involved in cell locomotion.
Research Articles on Coro1a
Similar Products
Product Notes
The Coro1a coro1a (Catalog #AAA1385831) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-461, full length protein. The amino acid sequence is listed below: SRQVVRSSKF RHVFGQPAKA DQCYEDVRVS QTTWDSGFCA VNPKFMALIC EASGGGAFLV LPLGKTGRVD KNVPLVCGHT APVLDIAWCP HNDNVIASGS EDCTVMVWEI PDGGLVLPLR EPVVTLEGHT KRVGIVAWHP TAQNVLLSAG CDNVILVWDV GTGAAVLTLG PDVHPDTIYS VDWSRDGALI CTSCRDKRVR VIEPRKGTVV AEKERPHEGT RPVHAVFVSE GKILTTGFSR MSERQVALWD TKHLEEPLSL QELDTSSGVL LPFFDPDTNI VYLCGKGDSS IRYFEITSEA PFLHYLSMFS SKESQRGMGY MPKRGLEVNK CEIARFYKLH ERKCEPIAMT VPRKSDLFQE DLYPPTAGPD PALTAEEWLS GRDAGPLLIS LKDGYVPPKS RELRVNRGLD SARRRATPEP SSTLSSDTVS RLEEDVRNLN AIVQKLQERL DRLEETVQAK. It is sometimes possible for the material contained within the vial of "Coronin-1A (Coro1a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
