Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Collagen alpha-1 (VII) chain (Col7a1) Recombinant Protein | Col7a1 recombinant protein

Recombinant Mouse Collagen alpha-1 (VII) chain (Col7a1) , partial

Gene Names
Col7a1; AW209154
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Collagen alpha-1 (VII) chain (Col7a1); Recombinant Mouse Collagen alpha-1 (VII) chain (Col7a1); partial; Col7a1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
39-212, partial, Provide the VWFA1 domain
Sequence
DIVFLLDGSSSIGRSNFREVRGFLEGLVLPFSGAASAQGVRFATVQYSDDPQTEFGLDTLGSGSDTIRAIRELSYKGGNTRTGAALHHVSDRVFLPRLTRPGVPKVCILITDGKSQDLVDTAAQKLKGQGVKLFAVGIKNADPEELKRVASQPTSDFFFFVNDFSILRTLLPLI
Sequence Length
212
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Col7a1 recombinant protein
This gene encodes the alpha chain of type VII collagen. The type VII collagen fibril, composed of three identical alpha collagen chains, is restricted to the basement zone beneath stratified squamous epithelia. It functions as an anchoring fibril between the external epithelia and the underlying stroma. Mutations in this gene are associated with all forms of dystrophic epidermolysis bullosa. In the absence of mutations, however, an acquired form of this disease can result from an autoimmune response made to type VII collagen.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
295,232 Da
NCBI Official Full Name
collagen alpha-1(VII) chain
NCBI Official Synonym Full Names
collagen, type VII, alpha 1
NCBI Official Symbol
Col7a1
NCBI Official Synonym Symbols
AW209154
NCBI Protein Information
collagen alpha-1(VII) chain
UniProt Protein Name
Collagen alpha-1(VII) chain
UniProt Gene Name
Col7a1
UniProt Synonym Gene Names
LC collagen

Uniprot Description

Stratified squamous epithelial basement membrane protein that forms anchoring fibrils which may contribute to epithelial basement membrane organization and adherence by interacting with extracellular matrix (ECM) proteins such as type IV collagen.

Research Articles on Col7a1

Similar Products

Product Notes

The Col7a1 col7a1 (Catalog #AAA1315735) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 39-212, partial, Provide the VWFA1 domain. The amino acid sequence is listed below: DIVFLLDGSS SIGRSNFREV RGFLEGLVLP FSGAASAQGV RFATVQYSDD PQTEFGLDTL GSGSDTIRAI RELSYKGGNT RTGAALHHVS DRVFLPRLTR PGVPKVCILI TDGKSQDLVD TAAQKLKGQG VKLFAVGIKN ADPEELKRVA SQPTSDFFFF VNDFSILRTL LPLI . It is sometimes possible for the material contained within the vial of "Collagen alpha-1 (VII) chain (Col7a1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.