Consortin (Cnst) Recombinant Protein | Cnst recombinant protein
Recombinant Mouse Consortin (Cnst)
Gene Names
Cnst; 9630058J23Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Consortin (Cnst); Recombinant Mouse Consortin (Cnst); Cnst recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-711aa; full length protein
Sequence
MDDSDPPTYSLQIEPQDGCHPGDSVERRVTRLPSVSDENENQLAGDGPAGLTTSEGAMGR ATVSEQDSLNNNESFPSSCEAAPTENAENTPSEGPKDDPPSLGQDQKLPAKRSPRAKKSS PKSAPPGDAVPVMQTQNATSQAAGEEEAAGVNANDPPKAPALQPLFSLIRGEVAQMDSRA LPLFLHQVAETYFQEEDYEKAMKFIQLERLYHEQLLANLSAIQEQWETKWKAVQPRTVTP LRNSEKGFNGEDFEQLAKICTTHQDPLLSKLKTAPVEPSPERKSLARAIMSEEAVGTEAA AKEPEIETCPSTDPSGDRHEEEPQESSPGCHQMEWQTASPELPGTAGKDHTEELPSSTNA TLDLHTQSLETAGSRSGPAAASNACKDSSCVPAPPTEDHCGVARDPKVAPPSESVAEQKL STGDDGALPGLISEGKYSQAHRKELCLPLQDAFEALPRDQPHSSEVAEPRQPDVTASDGK SAQSQAGLETGPESALCGDRKACDVSTLCLEVCMAPEERRDSEDRVSKETEDYLHSLLER CLKDAEDSLSYEDIQDDDSDLLQDLSPEEASYSLQEDLPPDESTLSLDDLAKKIEIAEAI PAEGLVSILKKRNDTVGSHPAQMQQKPAKRRVRFQEIDDNLEQDEVGGGSCILLILLCIA TVFLSVGGTALYCTLGNIESPVCTDFADNVDFYYTKLLQGVAGLKHWVYLS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Cnst recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45,414 Da
NCBI Official Full Name
consortin
NCBI Official Synonym Full Names
consortin, connexin sorting protein
NCBI Official Symbol
Cnst
NCBI Official Synonym Symbols
9630058J23Rik
NCBI Protein Information
consortin
UniProt Protein Name
Consortin
Protein Family
UniProt Gene Name
Cnst
UniProt Entry Name
CNST_MOUSE
Uniprot Description
CNST: Required for targeting of connexins to the plasma membrane. Belongs to the CNST family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Cellular Component: cytoplasmic vesicle; Golgi apparatus; integral to membrane; membrane; plasma membrane; protein complex; trans-Golgi network; transport vesicle
Molecular Function: phosphatase binding; protein binding
Biological Process: positive regulation of Golgi to plasma membrane protein transport
Research Articles on Cnst
Similar Products
Product Notes
The Cnst cnst (Catalog #AAA7011926) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-711aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Cnst cnst for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDDSDPPTYS LQIEPQDGCH PGDSVERRVT RLPSVSDENE NQLAGDGPAG LTTSEGAMGR ATVSEQDSLN NNESFPSSCE AAPTENAENT PSEGPKDDPP SLGQDQKLPA KRSPRAKKSS PKSAPPGDAV PVMQTQNATS QAAGEEEAAG VNANDPPKAP ALQPLFSLIR GEVAQMDSRA LPLFLHQVAE TYFQEEDYEK AMKFIQLERL YHEQLLANLS AIQEQWETKW KAVQPRTVTP LRNSEKGFNG EDFEQLAKIC TTHQDPLLSK LKTAPVEPSP ERKSLARAIM SEEAVGTEAA AKEPEIETCP STDPSGDRHE EEPQESSPGC HQMEWQTASP ELPGTAGKDH TEELPSSTNA TLDLHTQSLE TAGSRSGPAA ASNACKDSSC VPAPPTEDHC GVARDPKVAP PSESVAEQKL STGDDGALPG LISEGKYSQA HRKELCLPLQ DAFEALPRDQ PHSSEVAEPR QPDVTASDGK SAQSQAGLET GPESALCGDR KACDVSTLCL EVCMAPEERR DSEDRVSKET EDYLHSLLER CLKDAEDSLS YEDIQDDDSD LLQDLSPEEA SYSLQEDLPP DESTLSLDDL AKKIEIAEAI PAEGLVSILK KRNDTVGSHP AQMQQKPAKR RVRFQEIDDN LEQDEVGGGS CILLILLCIA TVFLSVGGTA LYCTLGNIES PVCTDFADNV DFYYTKLLQG VAGLKHWVYL S. It is sometimes possible for the material contained within the vial of "Consortin (Cnst), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
