Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chemokine-like receptor 1 (Cmklr1) Recombinant Protein | Cmklr1 recombinant protein

Recombinant Mouse Chemokine-like receptor 1 (Cmklr1)

Gene Names
Cmklr1; DEZ; Gpcr27; ChemR23; mcmklr1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chemokine-like receptor 1 (Cmklr1); Recombinant Mouse Chemokine-like receptor 1 (Cmklr1); Cmklr1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-371aa; Full length protein
Sequence
MEYDAYNDSGIYDDEYSDGFGYFVDLEEASPWEAKVAPVFLVVIYSLVCFLGLLGNGLVI VIATFKMKKTVNTVWFVNLAVADFLFNIFLPMHITYAAMDYHWVFGKAMCKISNFLLSHN MYTSVFLLTVISFDRCISVLLPVWSQNHRSIRLAYMTCSAVWVLAFFLSSPSLVFRDTAN IHGKITCFNNFSLAAPESSPHPAHSQVVSTGYSRHVAVTVTRFLCGFLIPVFIITACYLT IVFKLQRNRLAKNKKPFKIIITIIITFFLCWCPYHTLYLLELHHTAVPSSVFSLGLPLAT AVAIANSCMNPILYVFMGHDFRKFKVALFSRLANALSEDTGPSSYPSHRSFTKMSSLNEK ASVNEKETSTL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Cmklr1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,815 Da
NCBI Official Full Name
chemokine-like receptor 1
NCBI Official Synonym Full Names
chemokine-like receptor 1
NCBI Official Symbol
Cmklr1
NCBI Official Synonym Symbols
DEZ; Gpcr27; ChemR23; mcmklr1
NCBI Protein Information
chemokine-like receptor 1
UniProt Protein Name
Chemokine-like receptor 1
UniProt Gene Name
Cmklr1
UniProt Synonym Gene Names
Dez; Gpcr27
UniProt Entry Name
CML1_MOUSE

Uniprot Description

CMKLR1: Receptor for the chemoattractant adipokine chemerin/RARRES2 and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with RARRES2 induces activation of intracellular signaling molecules, such as SKY, MAPK1/3 (ERK1/2), MAPK14/P38MAPK and PI3K leading to multifunctional effects, like, reduction of immune responses, enhancing of adipogenesis and angionesis. Resolvin E1 down-regulates cytokine production in macrophages by reducing the activation of MAPK1/3 (ERK1/2) and NF- kappa-B. Acts as a coreceptor for several SIV strains (SIVMAC316, SIVMAC239, SIVMACL7E-FR and SIVSM62A), as well as a primary HIV-1 strain (92UG024-2). Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1

Cellular Component: integral to membrane; membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; signal transducer activity

Biological Process: chemotaxis; G-protein coupled receptor protein signaling pathway; inhibition of NF-kappaB transcription factor; negative regulation of interleukin-12 production; positive regulation of fat cell differentiation; regulation of calcium-mediated signaling; signal transduction

Research Articles on Cmklr1

Similar Products

Product Notes

The Cmklr1 cmklr1 (Catalog #AAA7011777) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-371aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Cmklr1 cmklr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEYDAYNDSG IYDDEYSDGF GYFVDLEEAS PWEAKVAPVF LVVIYSLVCF LGLLGNGLVI VIATFKMKKT VNTVWFVNLA VADFLFNIFL PMHITYAAMD YHWVFGKAMC KISNFLLSHN MYTSVFLLTV ISFDRCISVL LPVWSQNHRS IRLAYMTCSA VWVLAFFLSS PSLVFRDTAN IHGKITCFNN FSLAAPESSP HPAHSQVVST GYSRHVAVTV TRFLCGFLIP VFIITACYLT IVFKLQRNRL AKNKKPFKII ITIIITFFLC WCPYHTLYLL ELHHTAVPSS VFSLGLPLAT AVAIANSCMN PILYVFMGHD FRKFKVALFS RLANALSEDT GPSSYPSHRS FTKMSSLNEK ASVNEKETST L. It is sometimes possible for the material contained within the vial of "Chemokine-like receptor 1 (Cmklr1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.