Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chloride transport protein 6 (CLCN6) Recombinant Protein | CLCN6 recombinant protein

Recombinant Human Chloride transport protein 6 (CLCN6) , partial

Gene Names
CLCN6; CLC-6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chloride transport protein 6 (CLCN6); Recombinant Human Chloride transport protein 6 (CLCN6); partial; CLCN6 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
572-869; Partial
Sequence
NKGIYDIHVGLRGVPLLEWETEVEMDKLRASDIMEPNLTYVYPHTRIQSLVSILRTTVHHA FPVVTENRGNEKEFMKGNQLISNNIKFKKSSILTRAGEQRKRSQSMKSYPSSELRNMCD EHIASEEPAEKEDLLQQMLERRYTPYPNLYPDQSPSEDWTMEERFRPLTFHGLILRSQL VTLLVRGVCYSESQSSASQPRLSYAEMAEDYPRYPDIHDLDLTLLNPRMIVDVTPYMNP SPFTVSPNTHVSQVFNLFRTMGLRHLPVVNAVGEIVGIITRHNLTYEFLQARLRQHYQTI
Sequence Length
869
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
94,660 Da
NCBI Official Full Name
chloride transport protein 6 isoform 2
NCBI Official Synonym Full Names
chloride voltage-gated channel 6
NCBI Official Symbol
CLCN6
NCBI Official Synonym Symbols
CLC-6
NCBI Protein Information
chloride transport protein 6
UniProt Protein Name
Chloride transport protein 6
UniProt Gene Name
CLCN6
UniProt Synonym Gene Names
KIAA0046; ClC-6

NCBI Description

This gene encodes a member of the voltage-dependent chloride channel protein family. Members of this family can function as either chloride channels or antiporters. This protein is primarily localized to late endosomes and functions as a chloride/proton antiporter. Alternate splicing results in both coding and non-coding variants. Additional alternately spliced variants have been described but their full-length structure is unknown. [provided by RefSeq, Mar 2012]

Uniprot Description

Chloride transport protein, initially identified as voltage-gated chloride channel. The presence of the conserved gating glutamate residues suggests that is functions as antiporter.MiscellaneousThe CLC channel family contains both chloride channels and proton-coupled anion transporters that exchange chloride or another anion for protons. The presence of conserved gating glutamate residues is typical for family members that function as antiporters ().

Research Articles on CLCN6

Similar Products

Product Notes

The CLCN6 clcn6 (Catalog #AAA948315) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 572-869; Partial. The amino acid sequence is listed below: NKGIYDIHVG LRGVPLLEWE TEVEMDKLRA SDIMEPNLTY VYPHTRIQSL VSILRTTVHH A FPVVTENRGN EKEFMKGNQL ISNNIKFKKS SILTRAGEQR KRSQSMKSYP SSELRNMCD EHIASEEPAE KEDLLQQMLE RRYTPYPNLY PDQSPSEDWT MEERFRPLTF HGLILRSQL VTLLVRGVCY SESQSSASQP RLSYAEMAED YPRYPDIHDL DLTLLNPRMI VDVTPYMNP SPFTVSPNTH VSQVFNLFRT MGLRHLPVVN AVGEIVGIIT RHNLTYEFLQ ARLRQHYQTI . It is sometimes possible for the material contained within the vial of "Chloride transport protein 6 (CLCN6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.