CD274 protein
CD274 (B7-H1)-muIg-Biotin
CD274 mature EC: (224aa): (13)ftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvqhssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynkinqrilvvdvtseheltcqaegypkaeviwtssdhqvlsgkttttnskreeklfnvtstlrintttneifyctfrrldpeenhtaelvipelplahppnerthtr
Linker + Murine IgG2a Hinge + Fc (235aa):
(237)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg(471)
Predicted monomeric (non glycosylated) molecular weight: 54.4kd. The molecule is dimeric and runs at about 120 kd in SDS-PAGE under native conditions.
The molecule is dimeric and runs at about 120 kd in SDS-PAGE under native conditions.
Product should retain activity for at least 6 months after shipping date when stored as recommended.
NCBI and Uniprot Product Information
Uniprot Description
CD274: Involved in the costimulatory signal, essential for T- cell proliferation and production of IL10 and IFNG, in an IL2- dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production. Belongs to the immunoglobulin superfamily. BTN/MOG family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 9p24
Cellular Component: integral to membrane; plasma membrane; endomembrane system; external side of plasma membrane
Molecular Function: protein binding
Biological Process: regulation of activated T cell proliferation; cell surface receptor linked signal transduction; negative regulation of interleukin-10 production; negative regulation of activated T cell proliferation; negative regulation of interferon-gamma production; T cell costimulation; positive regulation of T cell proliferation; immune response; signal transduction
Research Articles on CD274
Similar Products
Product Notes
The CD274 cd274 (Catalog #AAA666818) is a Protein produced from CHO cells and is intended for research purposes only. The product is available for immediate purchase. The CD274 (B7-H1)-muIg-Biotin reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD274 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Researchers should empirically determine the suitability of the CD274 cd274 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MuCD8 alpha signal peptide residual amino acids + linker:(1) kpqapelrgs as CD274 mature EC: (224aa): (13)ftvtvp kdlyvveygs nmtieckfpv ekqldlaali vywemedkni iqfvhgeedl kvqhssyrqr arllkdqlsl gnaalqitdv klqdagvyrc misyggadyk ritvkvnapy nkinqrilvv dvtseheltc qaegypkaev iwtssdhqvl sgkttttnsk reeklfnvts tlrintttne ifyctfrrld peenhtaelv ipelplahpp nerthtrLinke r + Murine IgG2a Hinge + Fc (235aa):(237)gte prgptikpcp pckcpapnll ggpsvfifpp kikdvlmisl spivtcvvvd vseddpdvqi swfvnnvevh taqtqthred ynstlrvvsa lpiqhqdwms gkefkckvnn kdlpapiert iskpgsvrap qvyvlpppee emtkkqvtlt cmvtdfmped iyvewtnngk telnykntep vldsdgsyfm ysklrvekkn wvernsyscs vvheglhnhh ttksfsrtpg (471) . It is sometimes possible for the material contained within the vial of "CD274, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.
Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.