CD274 protein

CD274 (B7-H1)-muIg-Biotin

Cat. Num. AAA666818

• Gene Names: CD274; B7-H; B7H1; PDL1; PD-L1; PDCD1L1; PDCD1LG1
• Reactivity: Human
• Applications: ELISA
• Synonyms: CD274; CD274 (B7-H1)-muIg-Biotin; Human CD274(B7-H1)-muIg/Biotin Fusion Protein; CD274 protein

• Host: CHO cells
• Reactivity: Human
• Form/Format: 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 5% Glycerol, 0.2% BSA.
• Concentration: 0.5 mg/ml (varies by lot)
• Sequence: MuCD8 alpha signal peptide residual amino acids + linker:(1) kpqapelrgsas; ; CD274 mature EC: (224aa): (13)ftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvqhssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynkinqrilvvdvtseheltcqaegypkaeviwtssdhqvlsgkttttnskreeklfnvtstlrintttneifyctfrrldpeenhtaelvipelplahppnerthtr; ; Linker + Murine IgG2a Hinge + Fc (235aa):; (237)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg(471)
• Sequence Length: 127

• Applicable Applications for CD274 protein: ELISA (EIA)
• Molecular Structure: A soluble fusion protein consisting of the murine CD8 alpha leader sequence, the mature extracellular (224aa) domain of human CD274 fused to murine IgG2a Fc + hinge (233aa).
• Transfectant Cell Line: CHO
• Performance: Purity of recombinant protein was >90% by SDS-PAGE. N-terminal sequence was as predicted: KPQAP. Biotinylated recombinant protein was active in EIA, binding to anti-CD274 mAbs ANC6H1, clone M1H1, and recombinant CD279(PD1), using SA/HRP for detection.; ; Predicted monomeric (non glycosylated) molecular weight: 54.4kd. The molecule is dimeric and runs at about 120 kd in SDS-PAGE under native conditions.
• Conjugation: Biotin
• Production: Human CD274-muIg fusion protein was Protein A purified from (low FBS containing) tissue culture supernatant of CHO transfectants, and reacted with NHS-Biotin. Unconjugated Biotin was removed from conjugate by desalting column.
• Buffer: 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 5% Glycerol, 0.2% BSA, 0.04% NaN3 (as a preservative).
• Molecular Weight: Predicted monomeric (non glycosylated) molecular weight: 54.4kd.; The molecule is dimeric and runs at about 120 kd in SDS-PAGE under native conditions.
• Buffer: 50mM Sodium Phosphate pH7.5, 100mM Potassium Chloride, 150mM NaCl, 5% Glycerol, 0.2% BSA, 0.04% NaN3 (as a preservative).
• Preparation and Storage: Store at 2 - 5 degree C. Freeze/Thawing is not recommended; Product should retain activity for at least 6 months after shipping date when stored as recommended.

Related Product Information for CD274 protein

Information: CD274 (B7-H1, PD-L1, Programmed Death Ligand) is a member of the B7 family and is expressed on a variety of tissues including lymphoid cells. It plays an important role in regulation of T cell activation, and is involved in progression of cancer, arthritis and HIV infection (3). CD274 binding to its receptor CD279 (PD-1) on activated T cells can decrease proliferation. Conversely, ligation of CD279 on primed T cells can stimulate IL-10 production. High levels of CD274 present in Renal cell carcinoma are associated with poor prognosis (1). Tumor expressed CD274 can increase apoptosis of tumor specific T cells resulting in better tumor cell survival (2). Gamma Interferon and PHA can up regulate CD274 expression on T cells.

References

1)Cancer Research (April 2006) 66:3381. 2)J Molecular Medicine (Feb 2004) 81(5):281. 3)Int J Hematol (Nov 2003) 78(4):321.

NCBI and Uniprot Product Information

• NCBI GI #: 112363645
• NCBI GeneID: 29126
• NCBI Official Full Name: CD274, partial
• NCBI Official Synonym Full Names: CD274 molecule
• NCBI Official Symbol: CD274
• NCBI Official Synonym Symbols: B7-H; B7H1; PDL1; PD-L1; PDCD1L1; PDCD1LG1
• NCBI Protein Information: programmed cell death 1 ligand 1; B7 homolog 1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1
• UniProt Protein Name: Programmed cell death 1 ligand 1
• Protein Family: Programmed cell death
• UniProt Gene Name: CD274
• UniProt Synonym Gene Names: B7H1; PDCD1L1; PDCD1LG1; PDL1; PD-L1; PDCD1 ligand 1; Programmed death ligand 1; B7-H1
• UniProt Entry Name: PD1L1_HUMAN

Uniprot Description

CD274: Involved in the costimulatory signal, essential for T- cell proliferation and production of IL10 and IFNG, in an IL2- dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production. Belongs to the immunoglobulin superfamily. BTN/MOG family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 9p24

Cellular Component: integral to membrane; plasma membrane; endomembrane system; external side of plasma membrane

Molecular Function: protein binding

Biological Process: regulation of activated T cell proliferation; cell surface receptor linked signal transduction; negative regulation of interleukin-10 production; negative regulation of activated T cell proliferation; negative regulation of interferon-gamma production; T cell costimulation; positive regulation of T cell proliferation; immune response; signal transduction