Cofilin-2 (CFL2) Recombinant Protein | CFL2 recombinant protein

Recombinant Human Cofilin-2 (CFL2)

Cat. Num. AAA7054352

• Gene Names: CFL2; NEM7
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cofilin-2 (CFL2); Recombinant Human Cofilin-2 (CFL2); Cofilin; muscle isoform; CFL2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-166aa; Full Length
• Sequence: MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
• Sequence Length: –

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for CFL2 recombinant protein

Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. Its F-actin depolymerization activity is regulated by association with CSPR3. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods. Required for muscle maintenance. May play a role during the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere

Product Categories/Family for CFL2 recombinant protein

Signal Transduction

References

"Characterization of human muscle type cofilin (CFL2) in normal and regenerating muscle." Thirion C., Stucka R., Mendel B., Gruhler A., Jaksch M., Nowak K.J., Binz N., Laing N.G., Lochmuller H. Eur. J. Biochem. 268:3473-3482(2001)

NCBI and Uniprot Product Information

• NCBI GI #: 343887344
• NCBI GeneID: 1073
• NCBI Accession #: NP_001230574.1
• NCBI GenBank Nucleotide #: NM_001243645.1
• UniProt Accession #: Q9Y281; G3V5P4
• Molecular Weight: 45.7 kDa
• NCBI Official Full Name: cofilin-2 isoform 2
• NCBI Official Synonym Full Names: cofilin 2
• NCBI Official Symbol: CFL2
• NCBI Official Synonym Symbols: NEM7
• NCBI Protein Information: cofilin-2
• UniProt Protein Name: Cofilin-2
• Protein Family: Cofilin
• UniProt Gene Name: CFL2

NCBI Description

This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009]

Uniprot Description

Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. Its F-actin depolymerization activity is regulated by association with CSPR3 (PubMed:19752190). It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods. Required for muscle maintenance. May play a role during the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere ().