Chymotrypsin-like elastase family member 1 (CELA1) Recombinant Protein | CELA1 recombinant protein
Recombinant Human Chymotrypsin-like elastase family member 1 (CELA1)
Gene Names
CELA1; ELA1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chymotrypsin-like elastase family member 1 (CELA1); Recombinant Human Chymotrypsin-like elastase family member 1 (CELA1); CELA1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-258. Full Length of Mature Protein
Sequence
VVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIASN
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CELA1 recombinant protein
Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas or fecal material is actually referring to chymotrypsin-like elastase family, member 3B.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,798 Da
NCBI Official Full Name
chymotrypsin-like elastase family member 1
NCBI Official Synonym Full Names
chymotrypsin like elastase family member 1
NCBI Official Symbol
CELA1
NCBI Official Synonym Symbols
ELA1
NCBI Protein Information
chymotrypsin-like elastase family member 1
UniProt Protein Name
Chymotrypsin-like elastase family member 1
Protein Family
UniProt Gene Name
CELA1
UniProt Synonym Gene Names
ELA1
NCBI Description
Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas or fecal material is actually referring to chymotrypsin-like elastase family, member 3B. [provided by RefSeq, May 2009]
Uniprot Description
Acts upon elastin.
Research Articles on CELA1
Similar Products
Product Notes
The CELA1 cela1 (Catalog #AAA1402146) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-258. Full Length of Mature Protein. The amino acid sequence is listed below: VVGGTEAGRN SWPSQISLQY RSGGSRYHTC GGTLIRQNWV MTAAHCVDYQ KTFRVVAGDH NLSQNDGTEQ YVSVQKIVVH PYWNSDNVAA GYDIALLRLA QSVTLNSYVQ LGVLPQEGAI LANNSPCYIT GWGKTKTNGQ LAQTLQQAYL PSVDYAICSS SSYWGSTVKN TMVCAGGDGV RSGCQGDSGG PLHCLVNGKY SVHGVTSFVS SRGCNVSRKP TVFTQVSAYI SWINNVIASN . It is sometimes possible for the material contained within the vial of "Chymotrypsin-like elastase family member 1 (CELA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
